BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060081.seq (575 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32840.1 68417.m04670 phosphofructokinase family protein simi... 31 0.73 At2g22480.1 68415.m02667 phosphofructokinase family protein simi... 30 1.3 At4g29220.1 68417.m04180 phosphofructokinase family protein simi... 27 6.8 At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.8 At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.8 At5g56630.1 68418.m07070 phosphofructokinase family protein simi... 27 9.0 At4g35560.1 68417.m05053 expressed protein 27 9.0 At1g23780.1 68414.m03000 F-box family protein contains Pfam PF00... 27 9.0 >At4g32840.1 68417.m04670 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 462 Score = 30.7 bits (66), Expect = 0.73 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 103 NKITKDQREKYKFLHIAGMVGSIDNDFCGTDMTIGTDSALHRIIEAIDA 249 N I K+ R + + +AG+ +IDND D + G D+A+ AI+A Sbjct: 198 NAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA 246 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 285 IMEVMGRNCGYXALVAALASEAYQ-VFIPEDP 377 I+++MGR G+ A+ A LAS IPE P Sbjct: 260 IVKLMGRYSGFIAMYATLASRDVDCCLIPESP 291 >At2g22480.1 68415.m02667 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 537 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +3 Query: 285 IMEVMGRNCGYXALVAALASEAYQV-FIPEDP 377 ++++MGRN G+ A+ A+LAS + IPE P Sbjct: 348 VVKLMGRNSGFIAMQASLASGQVDICLIPEVP 379 >At4g29220.1 68417.m04180 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 473 Score = 27.5 bits (58), Expect = 6.8 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 109 ITKDQREKYKFLHIAGMVGSIDNDFCGTDMTIGTDSALHRIIEAIDA 249 I ++ R++ + +AG+ +IDND D + G D+A+ AI+A Sbjct: 200 IFEEIRKRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA 246 >At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 473 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 7 WIPRAAGIRHELTGANLFRQEWSSLLDELL 96 W P+ A +RH GA L W+S+++ ++ Sbjct: 347 WAPQVAVLRHRAVGAFLTHCGWNSVVEAVV 376 >At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 7 WIPRAAGIRHELTGANLFRQEWSSLLDEL 93 W P+ ++HE G N+ W+S+L+ + Sbjct: 332 WAPQVELLKHEAMGVNVTHCGWNSVLESV 360 >At5g56630.1 68418.m07070 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 485 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 288 MEVMGRNCGYXALVAALASEAYQ-VFIPEDP 377 +++MGR GY A+ A LAS IPE P Sbjct: 260 VKLMGRYSGYIAMYATLASRDVDCCLIPESP 290 >At4g35560.1 68417.m05053 expressed protein Length = 917 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/49 (20%), Positives = 23/49 (46%) Frame = +1 Query: 127 EKYKFLHIAGMVGSIDNDFCGTDMTIGTDSALHRIIEAIDAIVALLIHI 273 + K++ + G + I + IG+D ++E IDA+ + + + Sbjct: 406 QSVKYIKLTGSITCIQKSQNSKHLAIGSDQGHDSLVEVIDALTPVYLQV 454 >At1g23780.1 68414.m03000 F-box family protein contains Pfam PF00646: F-box domain; similar to SP:Q9Y3I1 F-box only protein 7 {Homo sapiens}; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 475 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 567 NTGNNGXTYCRVIKPPHXXPLGGDRITXAVXXHP 466 +TG +G + R+I P GDR+ ++ HP Sbjct: 416 STGRSGIRFPRIIGDPPFTWFNGDRMHGSIGIHP 449 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,153,451 Number of Sequences: 28952 Number of extensions: 225224 Number of successful extensions: 595 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -