BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060079.seq (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.08c |rps2||40S ribosomal protein S2|Schizosaccharomyces ... 42 8e-05 SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 27 2.6 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 2.6 SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces p... 25 7.8 SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity ... 25 7.8 >SPCC576.08c |rps2||40S ribosomal protein S2|Schizosaccharomyces pombe|chr 3|||Manual Length = 253 Score = 41.9 bits (94), Expect = 8e-05 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = +2 Query: 134 KEDQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDYSDV 262 ++++K WVPVTKLGRL + GKI +E I +S P+ +Y V Sbjct: 28 RDEEKEWVPVTKLGRLVKAGKIKSIEEI--YLYSLPIKEYQIV 68 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 27.1 bits (57), Expect = 2.6 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +3 Query: 345 PSPAISATSTRSSNPRFHTPTTPDLTSISINPLTP-Y*KEFAPGLKPPLSSEAPSAISPP 521 P ++S+ FHTPT P T +S +P + + PLS +A S S P Sbjct: 123 PPNSLSSQPKHQEFHLFHTPTIPRTTQLSSKTSSPIVIPDDNEQVASPLSKKAASLTSSP 182 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 348 SPAISATSTRSSNPRFHTPTTPDLTSIS 431 S IS +ST N FH PT TS S Sbjct: 801 SRTISTSSTNEYNTSFHAPTVSSTTSSS 828 >SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 277 Score = 25.4 bits (53), Expect = 7.8 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +3 Query: 354 AISATSTRSSNPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAISPP 521 A+ ++ S F PTT S+SI+P K A +P + ++ S S P Sbjct: 69 AVETNASASHETSFALPTTSPAASLSISPT----KSAAVSSEPNVEADVKSLSSTP 120 >SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity |Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 329 LMHQATLPCDLGYINPIIKSPIPYTNHP 412 + HQA L C GY + + +P+ N P Sbjct: 348 ICHQAILRCIYGYYHNLSLEELPFINVP 375 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,332,053 Number of Sequences: 5004 Number of extensions: 46099 Number of successful extensions: 197 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 197 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -