BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060079.seq (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ri... 45 5e-05 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 40 0.002 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 40 0.002 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 40 0.002 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 40 0.002 At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) 37 0.011 At3g06360.1 68416.m00734 arabinogalactan-protein (AGP27) 32 0.41 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 30 1.7 At5g49390.1 68418.m06112 hypothetical protein 29 2.2 At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family... 29 2.2 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 3.8 At1g30040.1 68414.m03673 gibberellin 2-oxidase / GA2-oxidase (GA... 28 5.1 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 28 6.7 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 28 6.7 At5g14220.1 68418.m01661 protoporphyrinogen oxidase, putative si... 28 6.7 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 28 6.7 At1g55040.1 68414.m06287 zinc finger (Ran-binding) family protei... 28 6.7 At1g73080.1 68414.m08450 leucine-rich repeat transmembrane prote... 27 8.9 At1g73070.1 68414.m08449 leucine-rich repeat family protein cont... 27 8.9 >At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ribosomal protein S2 - Arabidopsis thaliana, SWISSPROT:RS2_ARATH Length = 276 Score = 44.8 bits (101), Expect = 5e-05 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 +++ WVPVTKLGRL +EGKI K+E I HS P+ +Y Sbjct: 41 EEEKWVPVTKLGRLVKEGKITKIEQI--YLHSLPVKEY 76 >At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar to ribosomal protein S2 GI:430711 from [Drosophila melanogaster] Length = 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 ++ WVPVTKLGRL + KI KLE I HS P+ +Y Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQI--YLHSLPVKEY 84 >At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar to ribosomal protein S2 GI:939717 from [Urechis caupo] Length = 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 ++ WVPVTKLGRL + KI KLE I HS P+ +Y Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQI--YLHSLPVKEY 84 >At1g58684.1 68414.m06657 40S ribosomal protein S2, putative Length = 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 ++ WVPVTKLGRL + KI KLE I HS P+ +Y Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQI--YLHSLPVKEY 84 >At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar to ribosomal protein S2 GI:939717 from (Urechis caupo) Length = 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 ++ WVPVTKLGRL + KI KLE I HS P+ +Y Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQI--YLHSLPVKEY 84 >At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) Length = 285 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 140 DQKXWVPVTKLGRLXREGKIDKLESI*NTSHS*PLLDY 253 +++ WVPVTKLGRL G I ++E I HS P+ +Y Sbjct: 50 EEEKWVPVTKLGRLVAAGHIKQIEQI--YLHSLPVKEY 85 >At3g06360.1 68416.m00734 arabinogalactan-protein (AGP27) Length = 125 Score = 31.9 bits (69), Expect = 0.41 Identities = 23/60 (38%), Positives = 29/60 (48%) Frame = +3 Query: 342 LPSPAISATSTRSSNPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAISPP 521 LPSPA+S+T T S+ P D +S +P P FAP PP SS A + P Sbjct: 49 LPSPAVSSTQTIPSSSTLPEPENDD---VSADP-DP---AFAPSASPPASSLASLSSQAP 101 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 29.9 bits (64), Expect = 1.7 Identities = 21/59 (35%), Positives = 27/59 (45%) Frame = +3 Query: 345 PSPAISATSTRSSNPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAISPP 521 P+P S + + PR PT P +T P TP A + PP S PS+ SPP Sbjct: 26 PAPTRSPLPSPAQPPRTAAPT-PSITPTP-TP-TPSATPTAAPVSPPAGSPLPSSASPP 81 >At5g49390.1 68418.m06112 hypothetical protein Length = 422 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 348 SPAISATSTRSSNPRFHT-PTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAISP 518 +P ++A S+ SS P PD+T+ S +TP E A P +++ + ++I+P Sbjct: 300 NPGVTAASSTSSTQMEEADPYNPDVTAASSTSITP--MEVAEPYNPDVTAASSTSITP 355 >At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family protein identical to hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|9293881|dbj|BAB01784 Length = 532 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 331 YASSYPPLRSRLHQPDHQIPDSIHQPPQT 417 Y SS+P +RS H P + P + PP T Sbjct: 441 YVSSFPFIRSPSHSPQYASPAAYPSPPTT 469 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Frame = +3 Query: 345 PSPAISATSTRSSNPRFHTPTTPDLTSISINPLT----PY*KEFAPGLKPPLSSEAPSAI 512 PSP + + + S P T TTP + S P T P PP SS P ++ Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 513 SPP 521 PP Sbjct: 65 PPP 67 >At1g30040.1 68414.m03673 gibberellin 2-oxidase / GA2-oxidase (GA2OX2) identical to GI:4678368 ga2ox2 Length = 341 Score = 28.3 bits (60), Expect = 5.1 Identities = 19/84 (22%), Positives = 35/84 (41%) Frame = +2 Query: 356 DLGYINPIIKSPIPYTNHPRLNIYFHQSPDAVLEGVRAGVKASVVIRGSISYLTPSSLGM 535 D+G+I ++ + P + P+ + F Q+P E V +K + + + LG+ Sbjct: 106 DVGWIEYLLLNANPQLSSPKTSAVFRQTPQIFRESVEEYMKEIKEVSYKVLEMVAEELGI 165 Query: 536 AKGVSLPYFQVNDESQASRLXSRH 607 +L + DE S L H Sbjct: 166 EPRDTLSK-MLRDEKSDSCLRLNH 188 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 348 SPAISATSTRSSNPRF-HTPTTPDLTSISINPLTPY*KEFAPGLKPP 485 +P+ S+ T +S+P F H+ TP TS NP+ +E P + P Sbjct: 352 NPSSSSYPTSTSSPSFLHSHYTPSSTSFHTNPVYSMKQEQLPSNQIP 398 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Frame = +3 Query: 339 KLPSPAISATSTRSSNPRFHTPTT-PDLTSISINPLTPY*KE---FAPGLKPPLSSEAPS 506 K P+P + S + + TPT P TS P TP + P KPP S P Sbjct: 108 KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 Query: 507 AISPP 521 +PP Sbjct: 168 TTTPP 172 >At5g14220.1 68418.m01661 protoporphyrinogen oxidase, putative similar to protoporphyrinogen IX oxidase, mitochondrial (PPO II) from Nicotiana tabacum [SP|O24164], Glycine max, AB025102, Spinacia oleracea [GI:14349153]; contains Pfam amine oxidase, flavin-containing domain [PF015930] Length = 508 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 286 GHPFIRSHYYWRSR-P-YASSYPPLRSRLHQPDHQIP 390 G P +HYYWR P Y SSY + + + ++ +P Sbjct: 427 GEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLP 463 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +3 Query: 348 SPAISATSTRSSNPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAIS 515 SP + + SS+P +P P + + +PL P A + P SS P +++ Sbjct: 86 SPEVDSPLAPSSSPEVDSPQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLA 141 >At1g55040.1 68414.m06287 zinc finger (Ran-binding) family protein contains Pfam PF00641: Zn-finger in Ran binding protein and others; contains Prosite PS00018: EF-hand calcium-binding domain; similar to Zinc finger protein 265 (Zinc finger, splicing) (Fragment). (SP:Q9R020){Mus musculus} Length = 849 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = -1 Query: 412 GVVGVWNRGFDDRVDVAEIAGEGSLMHKGETANSNASG*RGGQHIDSFNCDVRVVQQRST 233 G +G GFDD D G GS +G G G +H S D V R++ Sbjct: 784 GRMGSRRGGFDDEFDRKSSRGRGSGSFRGSNRGGRGGGGGGNRHGHSDGKDTDVGDFRNS 843 >At1g73080.1 68414.m08450 leucine-rich repeat transmembrane protein kinase, putative similar to receptor protein kinase GI:1389566 from [Arabidopsis thaliana] Length = 1123 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 467 AGVKASVVIRGSISYLTPSSLGMAKGVSL 553 + + A V++ G++S PSSLGM K +++ Sbjct: 291 SSLDALVIVSGNLSGTIPSSLGMLKNLTI 319 >At1g73070.1 68414.m08449 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 598 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 467 AGVKASVVIRGSISYLTPSSLGMAKGVSL 553 + + A V++ G++S PSSLGM K +++ Sbjct: 289 SSLDALVIVSGNLSGTIPSSLGMLKNLTI 317 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,565,031 Number of Sequences: 28952 Number of extensions: 262295 Number of successful extensions: 885 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -