BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060078.seq (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 25 0.44 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 3.1 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 5.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.4 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 25.4 bits (53), Expect = 0.44 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 311 QDERKMSKRKKKVINNNKYILF-NSWYTKIKQPEWPSSPAMWDLVKNTPE 457 QDE K K + + + + F NS YT +K + W+ +N P+ Sbjct: 114 QDEEKNIKYRNLLETTTRRLAFVNSAYTLVKAYGFDGLDLAWEFPENKPK 163 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 37 HHKRIARLLGIKKIYHQEYKR 99 H A+L I++IYHQE ++ Sbjct: 144 HSDYRAKLAQIRQIYHQELEK 164 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 275 SFFPRNLNSN*LVHVGF 225 SF P+N+N+N HV + Sbjct: 42 SFKPQNINANLCTHVHY 58 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 9.4 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +2 Query: 2 GTRNVLSVRCVFITNELPGCWALKKYIIKNTSGSFQRFTKIKH 130 G++ L V+CVF+ W K+ + ++ G F H Sbjct: 775 GSKIHLFVKCVFLMGYQIFDWVQKEQSLAHSVGVFLTIFNAAH 817 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,622 Number of Sequences: 336 Number of extensions: 3825 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -