BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060077.seq (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 26 1.3 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 26 1.3 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 25 1.7 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 24 4.0 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 24 5.2 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 9.1 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 9.1 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 84 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 176 A K + ++ N P+QQS+T C+N+ Sbjct: 118 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 148 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 84 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 176 A K + ++ N P+QQS+T C+N+ Sbjct: 119 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 149 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 25.4 bits (53), Expect = 1.7 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 8/64 (12%) Frame = -3 Query: 424 IPHGRATRPLGLLDLSVPTVKQNVFIVV---NHLLLAFG-----HFAFVLHDRHYVEDIV 269 IP+ R RP+ L ++++P +Q F +HLLL G F L ++ +D V Sbjct: 556 IPYERTFRPMALSNINLPETEQFRFCNCGWPHHLLLPKGTAEGMKFDLFLMISNFADDTV 615 Query: 268 NVLF 257 N F Sbjct: 616 NQEF 619 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 633 FGVLQLVKRDFNNN 674 FGV LV RDFN+N Sbjct: 414 FGVADLVCRDFNSN 427 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 394 GLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVED 275 G + +S P+ + VFI +N + L G F +H++ + D Sbjct: 35 GNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTD 74 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +2 Query: 233 NCYCKFLEKKNINYILNVMPVMQDERKMSKRKKK 334 NC K K + I + ++Q+E++ +KR+++ Sbjct: 131 NCAMKEQNAKLLEQITGMCQLLQEEKEEAKRREE 164 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 121 TMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 26 TM DF P C+LD I + W C+ Sbjct: 150 TMVDFKLLQVIPYCVLDTITYMMGGYWYMACE 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,237 Number of Sequences: 2352 Number of extensions: 16583 Number of successful extensions: 23 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -