BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060071.seq (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.0 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 9.0 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 289 KSPSSLTKDFHNIGLLKSLTM*INIADSLKCWIRFL 182 K +S+ K+F + K L I + L CW FL Sbjct: 520 KVETSICKNFCFGFITKQLIFMIFVTYQLYCWSSFL 555 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 259 HNIGLLKSLTM*INIADSLKCWI 191 +NI K+L + INI ++ WI Sbjct: 185 YNIASSKTLKLSINIISLVQLWI 207 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,564 Number of Sequences: 336 Number of extensions: 2323 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -