BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060071.seq (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.12c |sds22||protein phosphatase regulatory subunit Sds22... 25 9.7 SPBC3B9.06c |apg3||autophagy associated protein Apg3 |Schizosacc... 25 9.7 >SPAC4A8.12c |sds22||protein phosphatase regulatory subunit Sds22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 25.0 bits (52), Expect = 9.7 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -1 Query: 410 NRIE*YNQHQK*-KLSVLVYKSERFKGFKALTAFRYCLSFAQIAFESHEGLS 258 N+I + +K KLS+L +S R F+ L +CL + + SH GL+ Sbjct: 180 NKITKFENFEKLQKLSLLSIQSNRITQFENLACLSHCL---RELYVSHNGLT 228 >SPBC3B9.06c |apg3||autophagy associated protein Apg3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 301 YRLHKSPSSLTKDFHNIGLL 242 +R H +P+S T DF N G++ Sbjct: 12 WREHITPASKTSDFENTGMI 31 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,202,304 Number of Sequences: 5004 Number of extensions: 39644 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -