BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060070.seq (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0086 + 19610899-19610992,19613399-19613652,19613744-196139... 29 4.6 01_06_1336 + 36396904-36397014,36397141-36397191,36397681-363977... 29 4.6 >02_04_0086 + 19610899-19610992,19613399-19613652,19613744-19613955, 19614059-19614320,19614432-19614728 Length = 372 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 286 PHLVTRQTDSTLMKIAYRYFNGQVSQHSPRNNIH 185 P +++R+ + + K AYR + GQV Q ++H Sbjct: 254 PAILSREDLTVIPKFAYRTYAGQVRQQGEHESLH 287 >01_06_1336 + 36396904-36397014,36397141-36397191,36397681-36397757, 36397876-36397963,36398616-36398891,36399002-36399250, 36400315-36400398 Length = 311 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 235 YMQFSLTCCLFVV*QDEGFDIFEEYLPPDTPTNWIYFDLKFD 360 Y+ L F V + G E+Y+PPD P+ W + +D Sbjct: 104 YLDLYLIHWPFRVKKGSGISNTEDYIPPDIPSTWGAMEKLYD 145 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,350,434 Number of Sequences: 37544 Number of extensions: 285900 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -