BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060070.seq (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110984-1|AAI10985.1| 514|Homo sapiens KPL2 protein protein. 31 3.8 AK058124-1|BAB71674.1| 514|Homo sapiens protein ( Homo sapiens ... 31 3.8 >BC110984-1|AAI10985.1| 514|Homo sapiens KPL2 protein protein. Length = 514 Score = 31.1 bits (67), Expect = 3.8 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = -2 Query: 415 KLYIERYRRNVNLA*GASGRT*GRNKSNWLVYQAADILQKYQIPHLVTRQTDSTLMKIAY 236 +LYI ++ + G +T R + L +D Q+ ++ H++ RQTD LM+I Y Sbjct: 99 QLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQE-RLRHMIPRQTDFNLMRITY 157 Query: 235 RY 230 R+ Sbjct: 158 RF 159 >AK058124-1|BAB71674.1| 514|Homo sapiens protein ( Homo sapiens cDNA FLJ25395 fis, clone TST02553. ). Length = 514 Score = 31.1 bits (67), Expect = 3.8 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = -2 Query: 415 KLYIERYRRNVNLA*GASGRT*GRNKSNWLVYQAADILQKYQIPHLVTRQTDSTLMKIAY 236 +LYI ++ + G +T R + L +D Q+ ++ H++ RQTD LM+I Y Sbjct: 99 QLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQE-RLRHMIPRQTDFNLMRITY 157 Query: 235 RY 230 R+ Sbjct: 158 RF 159 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,193,417 Number of Sequences: 237096 Number of extensions: 1585307 Number of successful extensions: 2886 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2885 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -