BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060070.seq (686 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024805-7|AAK39344.3| 248|Caenorhabditis elegans Hypothetical ... 29 4.1 U58734-5|AAB52504.3| 870|Caenorhabditis elegans Hypothetical pr... 28 7.2 >AC024805-7|AAK39344.3| 248|Caenorhabditis elegans Hypothetical protein Y51H7C.5 protein. Length = 248 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 337 SNWLVYQAADILQKYQIPHLVTRQTDSTLMKIAYRY 230 S W VY D + Y +P L+ ++ + MK A++Y Sbjct: 121 SEWRVYWFPDRIGLYLLPSLLRKEKSTMWMKRAFKY 156 >U58734-5|AAB52504.3| 870|Caenorhabditis elegans Hypothetical protein T27A10.6 protein. Length = 870 Score = 27.9 bits (59), Expect = 7.2 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -2 Query: 286 PHLVTRQTDSTLMKIAYRYFNGQVSQHSP--RNNIHVTSVSRHIYITFQRTVSTPS 125 P T + T KIA +FN SP RN + VT R F+ +TPS Sbjct: 535 PTTTTTTEEPTTRKIANSFFNSMEQYESPSQRNQVAVTQTPRR----FRGRTTTPS 586 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,604,763 Number of Sequences: 27780 Number of extensions: 304537 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -