BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060070.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 26 0.39 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 2.7 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 160 YITFQRTVSTPSLYNLLSI*LKRFI 86 YI T ST S++NL++I + R+I Sbjct: 262 YIAMDVTCSTSSIFNLVAISIDRYI 286 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.0 bits (47), Expect = 2.7 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 283 EGFDIFEEYLPPDTPTNWIYFDLKFDHSHLKQGSRFAC--IALY 408 +GF +F +L P N + L ++ G R C +ALY Sbjct: 180 KGFSLFARFLKNPRPCNVLATSLTEPYTLRNYGRRINCTYVALY 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,605 Number of Sequences: 438 Number of extensions: 4208 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -