BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060067.seq (591 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF036490-1|ABO65076.1| 124|Homo sapiens NADH:ubiquinone oxidore... 30 5.3 BC058920-1|AAH58920.1| 156|Homo sapiens NADH dehydrogenase (ubi... 30 5.3 AF087660-1|AAD23566.1| 156|Homo sapiens NADH:ubiquinone oxidore... 30 5.3 AC002400-1|AAC05814.1| 161|Homo sapiens Acyl carrier protein, M... 30 5.3 >EF036490-1|ABO65076.1| 124|Homo sapiens NADH:ubiquinone oxidoreductase SDAP subunit protein. Length = 124 Score = 30.3 bits (65), Expect = 5.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 253 LLAPKPNRTVSLCNHYRTSPP-SSEATATRILSILKL 360 +LA P R LC Y PP + E R+L +LKL Sbjct: 50 VLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKL 86 >BC058920-1|AAH58920.1| 156|Homo sapiens NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa protein. Length = 156 Score = 30.3 bits (65), Expect = 5.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 253 LLAPKPNRTVSLCNHYRTSPP-SSEATATRILSILKL 360 +LA P R LC Y PP + E R+L +LKL Sbjct: 53 VLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKL 89 >AF087660-1|AAD23566.1| 156|Homo sapiens NADH:ubiquinone oxidoreductase SDAP subunit protein. Length = 156 Score = 30.3 bits (65), Expect = 5.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 253 LLAPKPNRTVSLCNHYRTSPP-SSEATATRILSILKL 360 +LA P R LC Y PP + E R+L +LKL Sbjct: 53 VLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKL 89 >AC002400-1|AAC05814.1| 161|Homo sapiens Acyl carrier protein, Mitochondrial (ACP) (5'partial) protein. Length = 161 Score = 30.3 bits (65), Expect = 5.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 253 LLAPKPNRTVSLCNHYRTSPP-SSEATATRILSILKL 360 +LA P R LC Y PP + E R+L +LKL Sbjct: 58 VLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKL 94 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.316 0.126 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,840,110 Number of Sequences: 237096 Number of extensions: 1166465 Number of successful extensions: 2404 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2403 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6211568660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -