BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060066.seq (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 28 0.075 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.8 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 3.8 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 5.0 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 5.0 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 27.9 bits (59), Expect = 0.075 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 184 IKNLIVFFSFCCFLF 140 +K ++ FFSFCC LF Sbjct: 6 LKRVLFFFSFCCILF 20 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 186 ELKTLLFFFRFVVSYLFV 133 ELK +LFFF F F+ Sbjct: 5 ELKRVLFFFSFCCILFFI 22 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = -1 Query: 144 YLFVCNKALATILMHVCRAFKIVHPRQGH*RMAVFITQYIYNENILVP 1 Y F C + + + CRAF I+ P + +++ + + N++ P Sbjct: 286 YYFYCALIILLCIYYFCRAF-IIFPTHFYCAFSLYPLKSTFYLNVVRP 332 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 219 SCFLLYFQLKIELKTLLFFFR--FVVSYLFVCNKALATI 109 S +L+ + + LL F+ F+V+ L++CN+ T+ Sbjct: 256 SAYLISNPIMWDRVMLLTFWSAFFIVNVLYICNQCYNTV 294 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 516 RLYKGKRQTGRVTWPY 563 R K KRQ + WPY Sbjct: 122 RRMKDKRQRMAIAWPY 137 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 183 LKTLLFFFRFVVSYLFVCNKALATILMH 100 L ++L FF F ++ L + +A LMH Sbjct: 239 LGSILIFFIFPLAILIIVYILIAKTLMH 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,875 Number of Sequences: 336 Number of extensions: 2842 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -