BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060066.seq (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U12966-4|AAA20616.1| 365|Caenorhabditis elegans Carbonic anhydr... 28 6.5 Z70034-5|CAA93851.2| 197|Caenorhabditis elegans Hypothetical pr... 27 8.6 >U12966-4|AAA20616.1| 365|Caenorhabditis elegans Carbonic anhydrase protein 1 protein. Length = 365 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 213 FLLYFQLKIELKTLLFFFRFVVSYLFVCNKALAT 112 F L L I LK + + F ++LF CNK L T Sbjct: 85 FFLIIYLTISLKLMRYIF--TCAHLFACNKKLGT 116 >Z70034-5|CAA93851.2| 197|Caenorhabditis elegans Hypothetical protein C18E9.5 protein. Length = 197 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 399 SSXRRIYHRIGNATN*KD 346 S+ +RIYHRIG A N KD Sbjct: 112 STRKRIYHRIGIAPNDKD 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,520,348 Number of Sequences: 27780 Number of extensions: 250837 Number of successful extensions: 541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -