BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060065.seq (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 127 1e-29 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.17 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.67 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 3.6 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.6 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 6.2 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 6.2 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 28 6.2 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 6.2 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 8.3 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 8.3 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 8.3 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 127 bits (306), Expect = 1e-29 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = +3 Query: 255 SKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 428 +K AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 52 NKLAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWH 109 Score = 68.1 bits (159), Expect = 6e-12 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = +1 Query: 511 GHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLXAWSDILKVYKSQRLRAGXGKMRNRR 690 GH IEKI E+PLV++D ++ + KT AV L+ + A+ D+ K S+++RAG GKMRNRR Sbjct: 138 GHRIEKIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEKCIDSKKIRAGKGKMRNRR 197 Score = 62.1 bits (144), Expect = 4e-10 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +1 Query: 100 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 255 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAV 51 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 372 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 259 Y +HP T+ YH H R H Q+P + H + Q P Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTHRYQYQHP 268 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 372 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQ 265 Y +HP T+ YHH H + ++ Q+P + H + Q Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRYHQQ 447 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 Query: 363 HPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQP 262 HP T+ YH H R H Q+P + H + P Sbjct: 406 HPQVTHRYHQHPQLTH-RYHHQHPQVIHRYHQHP 438 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 274 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 304 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 396 TYVHHDTCYRRHPDRTYEYHHHGHA 322 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_25060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -2 Query: 405 WGRTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPPCY 253 +G ++ +D + + D +Y + + HA F H Y W+ D CY Sbjct: 309 YGDSHACYDASHACYDD-SYACYDNSHACFDESHACYGDSHAWYDDSHACY 358 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -2 Query: 399 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 295 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 276 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 392 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +3 Query: 294 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 422 G GR + R P GGG R G +G M GG P W R Sbjct: 271 GQGRGMGRGP---GGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHH 331 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 167 GRGLAAPCTVSLFSEYTDTKGRATDRLI 84 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 440 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 422 LAPSRQPPTAESGLGGSVAATGVPALVQAEDTL 520 +A R PP+ G G+V+ GVP L A++ L Sbjct: 169 MAMHRMPPSTLMGATGTVSTVGVPGLGGAQNPL 201 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 393 YVHHDTCYRRHPDRTYEYHHHGH 325 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHH 331 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHHGH 325 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 375 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 280 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +3 Query: 291 WGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 422 WG G+ + R GGG R G +G M GG P W R Sbjct: 24 WGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,494,026 Number of Sequences: 59808 Number of extensions: 425366 Number of successful extensions: 1262 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -