BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060065.seq (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal pro... 112 3e-25 U23523-9|AAC46564.1| 147|Caenorhabditis elegans Hypothetical pr... 29 4.2 AL132949-31|CAB61110.3| 297|Caenorhabditis elegans Hypothetical... 28 5.5 >AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal protein, large subunitprotein 4 protein. Length = 345 Score = 112 bits (269), Expect = 3e-25 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = +3 Query: 261 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 428 +AG Q SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG MFAP K +RRWH Sbjct: 56 KAGKQHSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGHMFAPLKVFRRWH 111 Score = 84.6 bits (200), Expect = 6e-17 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = +1 Query: 490 PSARSG*GHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLXAWSDILKVYKSQRLRAGX 669 P+ GH+I+++ E+PLVV+DKV+ KTK+AV+FLRR W+DI KVY S+R RAG Sbjct: 133 PALLQARGHVIDQVAEVPLVVSDKVESFRKTKEAVVFLRRSHLWADIEKVYNSKRNRAGK 192 Query: 670 GKMRNRR 690 GK+RNR+ Sbjct: 193 GKLRNRQ 199 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = +1 Query: 100 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 255 ARPLV+VY EK E Q + LP VF+ PIRPDLV+ + + +N RQ + V Sbjct: 3 ARPLVTVYDEKYEATQSQIR-LPAVFRTPIRPDLVSFIADQVRRNRRQAHAV 53 >U23523-9|AAC46564.1| 147|Caenorhabditis elegans Hypothetical protein F53A9.9 protein. Length = 147 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 387 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 304 HHD +++H + ++ HHHGH G H Sbjct: 120 HHDGHHKKHGRKEHD-HHHGH-HHGHHH 145 >AL132949-31|CAB61110.3| 297|Caenorhabditis elegans Hypothetical protein Y53F4B.36 protein. Length = 297 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/58 (22%), Positives = 25/58 (43%) Frame = +1 Query: 85 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVA 258 MS++V P +S V + + F++ P ++ D H+ + + CVA Sbjct: 182 MSMAVTSPYLSKLDRLPIVVSACKRAMCFIYDRPTNSIILLDTHMHFKRRAVSVLCVA 239 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,645,274 Number of Sequences: 27780 Number of extensions: 301368 Number of successful extensions: 965 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -