BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060060.seq (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 6.3 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 66 GESYHHHRIVQEYLSESYVNDMSCIER 146 G S H R + E++ S +D S +ER Sbjct: 1321 GSSEDHRRPLSEHIYSSIDSDYSTLER 1347 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 291 FTDVIVDARRFAV-LNQWERLLMESPASIILTASSKVQ 181 FT+ +V+ + LN+ +L SPA IIL SK + Sbjct: 2 FTENVVEELLSPLTLNRITHILANSPAIIILGQDSKAK 39 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 252 LNQWERLLMESPASIILTASSKVQ 181 LN+ +L SPA IIL SK + Sbjct: 54 LNRITHILANSPAIIILGQDSKAK 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,026 Number of Sequences: 438 Number of extensions: 3789 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -