BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060056.seq (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 130 1e-30 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 6e-18 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) 70 2e-12 SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) 70 2e-12 SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 64 8e-11 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 64 1e-10 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 62 3e-10 SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) 60 2e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 59 3e-09 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 58 7e-09 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 57 1e-08 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 57 1e-08 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) 51 1e-06 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 50 1e-06 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 50 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 50 2e-06 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) 46 2e-05 SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) 46 2e-05 SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11) 46 3e-05 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 46 3e-05 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 45 7e-05 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 41 9e-04 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_8614| Best HMM Match : Helicase_C (HMM E-Value=1.6e-18) 37 0.015 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_53656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.044 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.059 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 34 0.14 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 33 0.18 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.18 SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 33 0.18 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.18 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 33 0.18 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 33 0.24 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20) 33 0.24 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_4445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 33 0.31 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) 33 0.31 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 33 0.31 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 33 0.31 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 32 0.41 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 32 0.41 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.55 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.55 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 32 0.55 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.55 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.55 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.55 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.55 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 32 0.55 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.55 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.55 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.55 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 32 0.55 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.55 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.55 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.55 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 32 0.55 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 32 0.55 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.55 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.55 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 32 0.55 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 32 0.55 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 32 0.55 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 32 0.55 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 32 0.55 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 32 0.55 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.55 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 32 0.55 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 32 0.55 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 32 0.55 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 32 0.55 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 32 0.55 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 32 0.55 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 32 0.55 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 32 0.55 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 32 0.55 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 32 0.55 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 32 0.55 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.55 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 32 0.55 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 32 0.55 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 32 0.55 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 32 0.55 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 32 0.55 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 32 0.55 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 32 0.55 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 32 0.55 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 32 0.55 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.55 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 32 0.55 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 32 0.55 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 32 0.55 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 32 0.55 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 32 0.55 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 32 0.55 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 130 bits (313), Expect = 1e-30 Identities = 58/71 (81%), Positives = 64/71 (90%) Frame = +3 Query: 42 TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGD 221 TNL+RCTYLVLDEADRMLDMGFEPQIR II+QIRPDRQTLMWSATWPKEV+ LA D+L D Sbjct: 202 TNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSD 261 Query: 222 YIQINIGSLQL 254 Y+ I +GSL L Sbjct: 262 YVHITVGSLGL 272 Score = 55.6 bits (128), Expect = 4e-08 Identities = 26/60 (43%), Positives = 40/60 (66%) Frame = +2 Query: 254 SANHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYG 433 +ANH ILQIVD+C++HEKE+ + + G +T+IF ETKR+A+ ++R +R G Sbjct: 273 TANHKILQIVDVCEDHEKEHNVGSFIG--GIVILSSLQTLIFTETKRRADELTRKLRSDG 330 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 623 LGRTGRSKSKGTSYAFFTPSNSRQAKDLVSVLQEA 727 +GRT RS GTSY FFT +N++QAK+LVSVLQEA Sbjct: 374 IGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEA 408 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +1 Query: 553 DVDGIKYVINFDYPNSSEDYIHRIG 627 D+ IK+VINFD+PN +EDY+HRIG Sbjct: 351 DISDIKFVINFDFPNCTEDYVHRIG 375 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 88.2 bits (209), Expect = 6e-18 Identities = 45/77 (58%), Positives = 56/77 (72%), Gaps = 8/77 (10%) Frame = +3 Query: 36 QATNLQRCTYLVLDEADRMLDMGFEPQIRK--------IIEQIRPDRQTLMWSATWPKEV 191 + TN QRCTYLVLDEADRM DMGFEPQI K II+ IRPDRQT+M+SAT+P+++ Sbjct: 215 RVTNCQRCTYLVLDEADRMFDMGFEPQITKIRYPKVMRIIDCIRPDRQTVMFSATFPRQM 274 Query: 192 KKLAEDYLGDYIQINIG 242 + LA L I+I +G Sbjct: 275 EALARKILDKPIEIQVG 291 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 82.6 bits (195), Expect = 3e-16 Identities = 37/70 (52%), Positives = 56/70 (80%), Gaps = 4/70 (5%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSATWPKEVKKLAEDY 212 +L+ +L+LDEADRMLDMGFEP IR+I+E + + +RQTLM+SAT+P+E+++LA D+ Sbjct: 859 SLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQRLAGDF 918 Query: 213 LGDYIQINIG 242 L DY+ + +G Sbjct: 919 LNDYLFLTVG 928 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/43 (60%), Positives = 37/43 (86%) Frame = +1 Query: 499 QGRCASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 +GRC +L+AT+VAARGLD+D +K+VINFD P+ ++Y+HRIG Sbjct: 1010 KGRCP-VLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIG 1051 Score = 60.9 bits (141), Expect = 1e-09 Identities = 44/155 (28%), Positives = 71/155 (45%), Gaps = 1/155 (0%) Frame = +2 Query: 266 NILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYGWPAV 445 +I Q V ++EK ++L +L + G +T++FVE+KR A+ ++ + G+P Sbjct: 936 DIEQTVIEVTDNEKRDRLTQILGDAGTD-----RTLVFVESKRSADFLAIFLSGEGFPTT 990 Query: 446 CMHGDKTQQERDEVLYQFKEGXXXXXXXXXXXXXXXXXXVSNMXXXXXXXXXXXXTSIVL 625 +HGD+ QQER+E L F++G + Sbjct: 991 SIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRI 1050 Query: 626 GRTGRSKSKGTSYAFFTPS-NSRQAKDLVSVLQEA 727 GRTGR +KG + FF + + A+ LV VL EA Sbjct: 1051 GRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEA 1085 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 80.6 bits (190), Expect = 1e-15 Identities = 41/71 (57%), Positives = 54/71 (76%), Gaps = 4/71 (5%) Frame = +3 Query: 48 LQRCTYLVLDEADRMLDMGFEPQIRKIIEQ-IRPD---RQTLMWSATWPKEVKKLAEDYL 215 L +LVLDEADRMLDMGFEPQIR+I++Q P RQTLM+SAT+PKE++ LA D+L Sbjct: 997 LDSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFL 1056 Query: 216 GDYIQINIGSL 248 +YI + +G + Sbjct: 1057 ENYIFLAVGKV 1067 Score = 62.5 bits (145), Expect = 3e-10 Identities = 46/160 (28%), Positives = 73/160 (45%), Gaps = 2/160 (1%) Frame = +2 Query: 254 SANHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYG 433 S + NI Q V E +K + L LL G Q T++FVETK+ A+ + + + G Sbjct: 1069 STSENITQKVVWVDEFDKRSFLLDLLNASGPQQ----LTLVFVETKKGADALEMFLAKDG 1124 Query: 434 WPAVCMHGDKTQQERDEVLYQFKEGXXXXXXXXXXXXXXXXXXVSNMXXXXXXXXXXXXT 613 + +HGD++Q+ER+E L F+ G + N+ Sbjct: 1125 YYCTSIHGDRSQREREEALRTFRCG--DTPILVATAVAARGLDIPNVKHVINFDLPTDIE 1182 Query: 614 SIV--LGRTGRSKSKGTSYAFFTPSNSRQAKDLVSVLQEA 727 V +GRTGR G + +FF N AK+L+ +L+E+ Sbjct: 1183 EYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEES 1222 Score = 58.4 bits (135), Expect = 6e-09 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = +1 Query: 505 RCAS--ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 RC ILVAT VAARGLD+ +K+VINFD P E+Y+HRIG Sbjct: 1147 RCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIG 1189 >SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) Length = 445 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 224 N+ YLVLDEADRM+DMGFE +R I + RQTL++SAT PK+++ A+ L Sbjct: 13 NVSPYRYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKP 72 Query: 225 IQINIG 242 + +N+G Sbjct: 73 VTVNVG 78 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGE 630 +LVATDVA++GLD I++VINFD P E+Y+ G+ Sbjct: 140 VLVATDVASKGLDFPDIQHVINFDMPEDIENYVLLCGQ 177 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 365 KTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEG 508 + +IF E K ++I + G AV +HGDK+Q+ER + +F +G Sbjct: 89 QVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQG 136 >SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) Length = 212 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 224 N+ YLVLDEADRM+DMGFE +R I + RQTL++SAT PK+++ A+ L Sbjct: 13 NVSPYRYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKP 72 Query: 225 IQINIG 242 + +N+G Sbjct: 73 VTVNVG 78 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGE 630 +LVATDVA++GLD I++VINFD P E+Y+ G+ Sbjct: 140 VLVATDVASKGLDFPDIQHVINFDMPEDIENYVLLCGQ 177 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 365 KTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEG 508 + +IF E K ++I + G AV +HGDK+Q+ER + +F +G Sbjct: 89 QVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQG 136 >SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 68.1 bits (159), Expect = 7e-12 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = +3 Query: 99 MGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQL 254 MGFEP+I+KI+ IRPDRQT+M SATWP V+++A+ Y+ D +++ +G L L Sbjct: 1 MGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDL 52 Score = 61.7 bits (143), Expect = 6e-10 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 511 ASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 A IL+ATDVA+RGLD+ I YVIN+D+P EDY+HR+G Sbjct: 93 ARILIATDVASRGLDIKDITYVINYDFPRHIEDYVHRVG 131 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 623 LGRTGRSKSKGTSYAFFTPSNSRQAKDLVSVLQEA 727 +GRTGR+ GTS F + + R A L+ ++ +A Sbjct: 130 VGRTGRAGRSGTSLTFISREDWRSAHKLIKIMVQA 164 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 5/65 (7%) Frame = +3 Query: 63 YLVLDEADRMLDMGFEPQIRKIIEQ----IRPDRQTLMWSATWPKEVKKLAEDYL-GDYI 227 +L+LDEADRMLD+GF P I K+IE+ + RQTLM+SAT+P E++ LA +L DY+ Sbjct: 629 HLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSATFPDEIQHLAGSFLKPDYL 688 Query: 228 QINIG 242 + +G Sbjct: 689 FLAVG 693 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 64.5 bits (150), Expect = 8e-11 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = +3 Query: 24 SPGLQATNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLA 203 +P T+LQ LVLDEADR+LDMGF P + IIE + +RQTL++SAT + VK LA Sbjct: 189 TPNFDCTSLQ---ILVLDEADRILDMGFAPTLNAIIENLPSERQTLLYSATQTRSVKDLA 245 Query: 204 EDYLGDYI 227 L Y+ Sbjct: 246 RLSLQSYV 253 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 64.1 bits (149), Expect = 1e-10 Identities = 35/80 (43%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +1 Query: 391 EKS*EHIKEHQEIWLASCLYAWR*NSTRKR*SSVS-VQGRCASILVATDVAARGLDVDGI 567 EKS + E +E+ A + TR R Q + A ILV TD+A+RGLD + Sbjct: 706 EKSKKRRGEEREVVALRATKARGNSGTRIRCERFEKFQNKTADILVCTDIASRGLDTSDV 765 Query: 568 KYVINFDYPNSSEDYIHRIG 627 +VINFD+PNS DYIHR+G Sbjct: 766 SHVINFDFPNSMVDYIHRVG 785 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/55 (25%), Positives = 33/55 (60%) Frame = +2 Query: 296 EHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYGWPAVCMHGD 460 +HEK ++ LL++ S+ PG +TI+F + + ++R++ ++ + +HG+ Sbjct: 636 QHEKAERIVELLKK--DSKSPG-QTIVFCNSASSCDWLARHLEQHNLSLIRLHGN 687 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = +3 Query: 60 TYLVLDEADRMLDMGFEPQIRKIIEQIRPDR--QTLMWSATWPKEVKKLAEDYLGDYIQI 233 T+LV+DEAD M D F+ +I+ I + + +E + D L Q+ Sbjct: 531 THLVIDEADTMFDASFKSLTMEILHTINSSEYGSKECYISRQIRECQAPPPDQLPIDAQV 590 Query: 234 NIGSLQLPQ 260 I LPQ Sbjct: 591 TIAGATLPQ 599 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/76 (44%), Positives = 49/76 (64%), Gaps = 3/76 (3%) Frame = +3 Query: 24 SPGLQATNLQRCTYLVLDEADRMLDMGFEPQIRKII---EQIRPDRQTLMWSATWPKEVK 194 +PG + +L + TYLV+DE DRML MG E Q+RKI+ RQTL+WSAT P+ ++ Sbjct: 224 TPG-RLLDLYKITYLVMDEPDRMLGMGMEEQLRKIVGLATGTSRARQTLLWSATLPESLE 282 Query: 195 KLAEDYLGDYIQINIG 242 +LA + + I I +G Sbjct: 283 RLARSAVLNPITIQVG 298 Score = 51.2 bits (117), Expect = 8e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 ILVATDVA+RGLD + +VIN+D P++ E YIHR G Sbjct: 385 ILVATDVASRGLDFPEVTHVINYDLPDTIECYIHRCG 421 >SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) Length = 127 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/58 (48%), Positives = 42/58 (72%) Frame = +3 Query: 66 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 239 LVLDEADRMLDMGF IR+++ ++ RQ L++SAT+ ++K LAE L + ++I + Sbjct: 7 LVLDEADRMLDMGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEIEV 64 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/74 (39%), Positives = 46/74 (62%) Frame = +3 Query: 36 QATNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYL 215 QA +L V+DE D ML +GFE Q+++I+E++ RQT+++SAT P ++ +A L Sbjct: 273 QAVDLTHVIGCVVDEVDTMLQLGFEQQVQQILERLSNRRQTMLFSATIPPSIEAMASRLL 332 Query: 216 GDYIQINIGSLQLP 257 + I+ GS LP Sbjct: 333 NAPVFISAGSPSLP 346 Score = 31.9 bits (69), Expect = 0.55 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 511 ASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 A + V + + A L + + VINFD P + E+Y+H+IG Sbjct: 380 AVVFVESKLGADML-AEAVSKVINFDMPPTYEEYVHQIG 417 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/70 (41%), Positives = 45/70 (64%) Frame = +1 Query: 418 HQEIWLASCLYAWR*NSTRKR*SSVSVQGRCASILVATDVAARGLDVDGIKYVINFDYPN 597 +Q+ + A+ L+ R N ++ + S++G ILVATDVA RG+D+ + +VIN+D Sbjct: 305 NQKKFRATTLHGGR-NQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAK 363 Query: 598 SSEDYIHRIG 627 + EDY HRIG Sbjct: 364 TIEDYTHRIG 373 Score = 45.6 bits (103), Expect = 4e-05 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 24/76 (31%) Frame = +3 Query: 60 TYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------------------RQTLMW 167 T V+ ADRM+DMGFEP+++KI+E ++PD RQT+M+ Sbjct: 209 TVSVIGGADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMF 268 Query: 168 SATWPKEVKKLAEDYL 215 +AT P +V++LA++YL Sbjct: 269 TATMPPQVERLAKNYL 284 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/78 (34%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 224 ++ +C LV+DEAD++L M F+ + +II+ + +RQ L++SAT+P V+ E +L Sbjct: 193 DMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKP 252 Query: 225 IQINI-GSLQLPQITTFF 275 +IN+ L L +T ++ Sbjct: 253 YEINLMDELTLHGVTQYY 270 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = +1 Query: 499 QGRCASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTF 642 QG C + LV +D+ RG+D+ + VINFD+P +SE Y+HRIG + F Sbjct: 339 QGHCRN-LVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 385 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/78 (34%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 224 ++ +C LV+DEAD++L M F+ + +II+ + +RQ L++SAT+P V+ E +L Sbjct: 193 DMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKP 252 Query: 225 IQINI-GSLQLPQITTFF 275 +IN+ L L +T ++ Sbjct: 253 YEINLMDELTLHGVTQYY 270 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = +1 Query: 499 QGRCASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTF 642 QG C + LV +D+ RG+D+ + VINFD+P +SE Y+HRIG + F Sbjct: 339 QGHCRN-LVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 385 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFL 672 +L++TDV ARGLDV + VIN+D PN+ E YIHRIG + F K I F+ Sbjct: 289 VLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFV 340 Score = 51.6 bits (118), Expect = 6e-07 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 9/100 (9%) Frame = +3 Query: 3 GRSRTSGSPG-----LQATNLQRCTY--LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTL 161 G+ SG+PG ++ NL+ + LVLDEAD ML+ GF+ QI + + P Q + Sbjct: 115 GQHIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVV 174 Query: 162 MWSATWPKEVKKLAEDYLGDYIQINI--GSLQLPQITTFF 275 + SAT P E+ ++ ++ D I+I + L L I FF Sbjct: 175 LLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFF 214 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/114 (21%), Positives = 45/114 (39%) Frame = +2 Query: 365 KTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEGXXXXXXXXXXXX 544 + +IF TKRK + ++ +R + MHGD Q+ER+ ++ F+ G Sbjct: 238 QAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWA 297 Query: 545 XXXXXXVSNMXXXXXXXXXXXXTSIVLGRTGRSKSKGTSYAFFTPSNSRQAKDL 706 ++ +GR+GR KG + F + R +D+ Sbjct: 298 RGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDI 351 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 52.4 bits (120), Expect = 4e-07 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +3 Query: 30 GLQATNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAE 206 G NLQ C LV+DEADR+L++GFE ++R+II + RQT+++SAT K V+ LA+ Sbjct: 714 GFLYKNLQ-C--LVIDEADRILEIGFEEEMRQIIRILPSKRQTVLFSATQTKNVEDLAK 769 Score = 46.4 bits (105), Expect = 2e-05 Identities = 17/39 (43%), Positives = 29/39 (74%) Frame = +1 Query: 511 ASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 + IL+ TDVAARGLD+ + +++ +D + ++YIHR+G Sbjct: 869 SGILLCTDVAARGLDIPEVDWIVQYDPADDPKEYIHRVG 907 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 51.6 bits (118), Expect = 6e-07 Identities = 32/71 (45%), Positives = 41/71 (57%) Frame = +3 Query: 36 QATNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYL 215 +ATNL R TYLV DEADRM DMGF L++SAT+ K+V+ L D L Sbjct: 658 KATNLHRVTYLVFDEADRMFDMGF----------------ALLFSATFKKKVEHLCRDIL 701 Query: 216 GDYIQINIGSL 248 D +++ IG L Sbjct: 702 VDPVRVVIGEL 712 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +2 Query: 371 IIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKE 505 +IFV K +E ++ N+R+ + +HGD Q ER +VL QFK+ Sbjct: 733 LIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKK 777 >SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) Length = 331 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/56 (39%), Positives = 34/56 (60%) Frame = +1 Query: 511 ASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFLYP 678 + ILV TDV ARG+D+ + +VI +D P+S+ ++HR G + N + FL P Sbjct: 141 SGILVCTDVMARGVDIPEVNWVIQYDPPSSANAFVHRCGRTARIGNEGNAVVFLLP 196 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +3 Query: 99 MGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 239 MGFE I I+ + R+T ++SAT EV+ L L + +++ + Sbjct: 1 MGFEASINTILGYLPKQRRTGLFSATQTDEVEALVRAGLRNPVRVTV 47 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 ILVATDVA+RGLD+ ++ V+N + P +DYIHR+G Sbjct: 300 ILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVG 336 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 176 NL++ +LVLDEADR+LD F ++ I + + RQTL++SAT Sbjct: 147 NLKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSAT 190 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/42 (45%), Positives = 29/42 (69%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTF 642 IL++TD+ ARG+D + + V+N D P++ E Y+HRIG F Sbjct: 267 ILISTDLTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGRF 308 Score = 41.1 bits (92), Expect = 9e-04 Identities = 18/58 (31%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +3 Query: 69 VLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGD--YIQIN 236 +LDEAD++LD F+ QI I + ++Q + +SAT+P+ + + Y+ + ++++N Sbjct: 160 ILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKYMTEPTFVRLN 217 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 +L+AT++ RG+D G+ VIN+D+P S+ YIHRIG Sbjct: 436 VLIATELMGRGIDFKGVNLVINYDFPTSAVAYIHRIG 472 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 4/80 (5%) Frame = +3 Query: 15 TSGSPGLQATNLQRCTYLVLDEADRMLDM---GFEPQIRKIIEQI-RPDRQTLMWSATWP 182 T PG++ N++ +L+LDEAD++ + GF QI I + +PD ++SAT Sbjct: 272 TQEPPGIELHNVE---WLILDEADKLFEEGKDGFREQIATIYQACNKPDIHRGLFSATLS 328 Query: 183 KEVKKLAEDYLGDYIQINIG 242 +++ A +L +++++ +G Sbjct: 329 NGIEEWAGLHLDNHVRVTVG 348 Score = 35.5 bits (78), Expect = 0.044 Identities = 23/98 (23%), Positives = 46/98 (46%), Gaps = 2/98 (2%) Frame = +2 Query: 221 LHSDQYRIITTSANHNILQIVD--ICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 394 LH D + +T ++ VD + ++ KL + + + P +IFV++K Sbjct: 337 LHLDNHVRVTVGIRNSATATVDQELLFVGQESGKLLAVRDIVQKGFTP--PVLIFVQSKD 394 Query: 395 KAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEG 508 +A+ + + G +H D+TQ +RD ++ F+ G Sbjct: 395 RAKELFHELIYDGINVDVIHSDRTQAQRDNIVKSFRTG 432 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 +L+ATDVAARGLD+ I++VI++ P E Y+HR G Sbjct: 509 LLLATDVAARGLDIANIEHVIHYQVPKDPEVYVHRSG 545 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +3 Query: 42 TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 140 +N+Q YLV+DEADRM++ G ++ I+E I Sbjct: 335 SNIQLLRYLVIDEADRMVEQGHYEELSSILELI 367 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHR 621 +L+ TD+ ARG+DV + VIN+D P++ E+YIHR Sbjct: 383 VLITTDLLARGIDVHQVSLVINYDLPSNRENYIHR 417 Score = 45.2 bits (102), Expect = 5e-05 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 224 N + VLDEAD ML GF+ QI + ++ Q ++ SAT P +V ++ ++ D Sbjct: 230 NTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDV 289 Query: 225 IQINI--GSLQLPQITTFFKL 281 ++I + + L I FF L Sbjct: 290 VRILVKREEVTLEGIKQFFVL 310 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +2 Query: 365 KTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEG 508 + +IF T+RK + ++ + MHGD +Q+ERD ++ +F+ G Sbjct: 332 QAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMSQKERDIIMKEFRSG 379 >SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 46.4 bits (105), Expect = 2e-05 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 544 RGLDVDGIKYVINFDYPNSSEDYIHRIGENWTF 642 RG+D+ + VINFD+P +SE Y+HRIG + F Sbjct: 5 RGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 37 >SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 46.4 bits (105), Expect = 2e-05 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +1 Query: 544 RGLDVDGIKYVINFDYPNSSEDYIHRIGENWTF 642 RG+D+ + VINFD+P +SE Y+HRIG + F Sbjct: 5 RGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 37 >SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11) Length = 87 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFL 672 +LVAT++ RG+D++ + V N+D P S+ Y+HR+ F K I F+ Sbjct: 15 MLVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFV 66 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFL 672 +LVAT++ RG+D++ + V N+D P S+ Y+HR+ F K I F+ Sbjct: 388 MLVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFV 439 Score = 37.5 bits (83), Expect = 0.011 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +2 Query: 263 HNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYGWPA 442 H + Q +++EK KL LL + +Q IIFV++ ++ +S + + +PA Sbjct: 308 HGLQQYYVKLKDNEKNRKLFDLLDLLEFNQ-----VIIFVKSVQRCTALSHLLLKQNFPA 362 Query: 443 VCMHGDKTQQERDEVLYQFK 502 +C+H Q+ER QFK Sbjct: 363 ICIHRGMKQEERLARYQQFK 382 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/43 (41%), Positives = 30/43 (69%) Frame = +1 Query: 499 QGRCASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 Q + ++V TDVAARG+D+ + VINF +P ++ ++HR+G Sbjct: 522 QHKKTMVMVVTDVAARGIDIPMLDNVINFHFPPKAKLFVHRVG 564 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/52 (46%), Positives = 31/52 (59%) Frame = +1 Query: 520 LVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFLY 675 LVATDVAARGLD+ I V+ + P + YIHR G T + R IC ++ Sbjct: 358 LVATDVAARGLDIPEIDLVVQCEPPKDVDAYIHRSGR--TGRAGREGICIVF 407 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 5/62 (8%) Frame = +3 Query: 45 NLQRCTYLVLDEADRMLDMGFEPQIRKII----EQIRPDR-QTLMWSATWPKEVKKLAED 209 +L + ++VLDE DRMLDMGF + +++ + R D+ QTL++SAT P A+ Sbjct: 216 DLSKLKHVVLDEVDRMLDMGFAESVEEVLAASYAEDREDKPQTLLFSATLPPWAVNTAKK 275 Query: 210 YL 215 Y+ Sbjct: 276 YM 277 Score = 33.9 bits (74), Expect = 0.14 Identities = 25/105 (23%), Positives = 42/105 (40%) Frame = +2 Query: 365 KTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEGXXXXXXXXXXXX 544 +T+IF +TK++A ++ N V +HGD Q++R+ L F+EG Sbjct: 307 RTMIFAQTKKEANELALNSVLKQETQV-LHGDIPQKQREVTLKSFREGKFRCLVATDVAA 365 Query: 545 XXXXXXVSNMXXXXXXXXXXXXTSIVLGRTGRSKSKGTSYAFFTP 679 ++ GRTGR+ +G F+ P Sbjct: 366 RGLDIPEIDLVVQCEPPKDVDAYIHRSGRTGRAGREGICIVFYKP 410 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 41.1 bits (92), Expect = 9e-04 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSS------EDYIHRIGENWTF 642 +L+ T+V+ARG+DV+ + VIN+D P E Y+HRIG F Sbjct: 397 LLITTNVSARGIDVEQVTLVINYDMPMDMQGKADFETYLHRIGRTGRF 444 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/81 (24%), Positives = 37/81 (45%) Frame = +2 Query: 266 NILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYGWPAV 445 NI Q +C+ E+K L G + ++F T+R A ++ + + G Sbjct: 317 NIKQYYVVCKN--SEDKFEALCNMYGVLSI--GQCVVFCHTRRNAAWLAEKMVKEGHAVA 372 Query: 446 CMHGDKTQQERDEVLYQFKEG 508 + G+ T ++R VL +F+ G Sbjct: 373 LLSGEITIEQRIAVLERFRLG 393 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -2 Query: 139 ICSMIFLICGSNPIS-NIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 I +I +I S+ S N+ S S T V +++C PGDPLVLERP Sbjct: 33 IIIIIIIISSSSSSSINVASIISTTTSVLITIIISCIPGDPLVLERP 79 >SB_8614| Best HMM Match : Helicase_C (HMM E-Value=1.6e-18) Length = 282 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 514 SILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 ++LVAT V GLDV +V+ FD+P + Y+ G Sbjct: 146 NLLVATSVVEEGLDVPKCNFVVRFDFPQNFRSYVQSKG 183 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.9 bits (79), Expect = 0.034 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 6/40 (15%) Frame = -2 Query: 103 PISNIRSASSRT------KYVHRCKLVACSPGDPLVLERP 2 P+ NIR S+T HR + +CSPGDPLVLERP Sbjct: 37 PVGNIREGISKTIMSEKGTVTHR-RSNSCSPGDPLVLERP 75 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.034 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 58 HRCKLVACSPGDPLVLERP 2 H+ K +CSPGDPLVLERP Sbjct: 15 HKAKSNSCSPGDPLVLERP 33 >SB_53656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +3 Query: 42 TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 140 +N+Q YLV+DEADRM++ G ++ I+E I Sbjct: 6 SNVQLLRYLVIDEADRMVEQGHYEELSSILELI 38 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 35.5 bits (78), Expect = 0.044 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 CK +CSPGDPLVLERP Sbjct: 187 CKSNSCSPGDPLVLERP 203 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.044 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = -2 Query: 139 ICSMIFLICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 I + I L+ +P ++ + K+ +C +CSPGDPLVLERP Sbjct: 9 ISANIRLLVLKSPTASYSKTQAVEKF-KKCTSNSCSPGDPLVLERP 53 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.1 bits (77), Expect = 0.059 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 67 KYVHRCKLVACSPGDPLVLERP 2 +Y+H +CSPGDPLVLERP Sbjct: 342 QYLHSIVSNSCSPGDPLVLERP 363 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -2 Query: 121 LICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 L G+ P S + S S +++ +CSPGDPLVLERP Sbjct: 61 LYSGNPPSSQVFSQSPLSRFTSN----SCSPGDPLVLERP 96 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.1 bits (77), Expect = 0.059 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 61 VHRCKLVACSPGDPLVLERP 2 +H K +CSPGDPLVLERP Sbjct: 7 IHNHKSNSCSPGDPLVLERP 26 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.7 bits (76), Expect = 0.078 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 97 SNIRSASSRTKYVHRCKLVA--CSPGDPLVLERP 2 +NI RT+ C+ + CSPGDPLVLERP Sbjct: 11 ANIAYIRQRTRVASLCRSRSNSCSPGDPLVLERP 44 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -2 Query: 85 SASSRTKYVHRCKLVACSPGDPLVLERP 2 SA+ R + K +CSPGDPLVLERP Sbjct: 10 SANIRRPTIQARKSNSCSPGDPLVLERP 37 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 64 YVHRCKLVACSPGDPLVLERP 2 YV R +CSPGDPLVLERP Sbjct: 3470 YVARVVSNSCSPGDPLVLERP 3490 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C+ +CSPGDPLVLERP Sbjct: 18 CRSNSCSPGDPLVLERP 34 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 100 ISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 ++NI++ S + +CSPGDPLVLERP Sbjct: 5 VANIQATSYFLRNSSNISSNSCSPGDPLVLERP 37 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/18 (83%), Positives = 16/18 (88%), Gaps = 1/18 (5%) Frame = -2 Query: 52 CKLV-ACSPGDPLVLERP 2 CKL +CSPGDPLVLERP Sbjct: 5 CKLSNSCSPGDPLVLERP 22 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSG 57 AAALELVDPPGCR + G Sbjct: 10 AAALELVDPPGCRNSMFYG 28 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C+ +CSPGDPLVLERP Sbjct: 35 CESNSCSPGDPLVLERP 51 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = -2 Query: 124 FLICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 ++ CG SN R R +CSPGDPLVLERP Sbjct: 62 WVTCGEQN-SNDRRGEECLTLTQRIVSNSCSPGDPLVLERP 101 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 55 RCKLVACSPGDPLVLERP 2 R K +CSPGDPLVLERP Sbjct: 26 RAKSNSCSPGDPLVLERP 43 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 58 HRCKLVACSPGDPLVLERP 2 H K +CSPGDPLVLERP Sbjct: 3 HEKKSNSCSPGDPLVLERP 21 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C +CSPGDPLVLERP Sbjct: 2 CSSNSCSPGDPLVLERP 18 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 Query: 70 TKYVHRCKLVACSPGDPLVLERP 2 T YV + +CSPGDPLVLERP Sbjct: 5 TLYVKLERSNSCSPGDPLVLERP 27 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +3 Query: 3 GRSRTSGSPGLQATNLQRC 59 GRSRTSGSPGLQ ++++C Sbjct: 10 GRSRTSGSPGLQEFDMRKC 28 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSG 57 AAALELVDPPGCR + G Sbjct: 10 AAALELVDPPGCRNSMHIG 28 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C +CSPGDPLVLERP Sbjct: 190 CSSNSCSPGDPLVLERP 206 >SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 502 GRCASILVATDVAARGLDVDGIKYVINFD 588 G +I++AT VA GLD+D YVI +D Sbjct: 614 GSECNIIIATTVAEEGLDIDDCSYVIRYD 642 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 103 PISNIRSASSRTKYVH-RCKLVACSPGDPLVLERP 2 P++ + R+ H R +CSPGDPLVLERP Sbjct: 37 PVARLARYCMRSPDAHCRVPSNSCSPGDPLVLERP 71 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSGAH 63 AAALELVDPPGCR + H Sbjct: 10 AAALELVDPPGCRNSIVTKVH 30 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSGA 60 AAALELVDPPGCR + A Sbjct: 10 AAALELVDPPGCRNSIHEAA 29 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -2 Query: 97 SNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 SN S++ T + +CSPGDPLVLERP Sbjct: 7 SNSLSSAKNTIGSYEVTSNSCSPGDPLVLERP 38 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 64 YVHRCKLVACSPGDPLVLERP 2 ++HR +CSPGDPLVLERP Sbjct: 10 HIHRASN-SCSPGDPLVLERP 29 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 61 VHRCKLVACSPGDPLVLERP 2 V R + +CSPGDPLVLERP Sbjct: 6 VKRTRSNSCSPGDPLVLERP 25 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 30 GLQATNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQ 155 G+ + + LVLDEAD ML+ GF+ QI + + P Q Sbjct: 27 GIDKLDTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQ 68 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 89 SCSPGDPLVLERP 101 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 67 KYVHRCKLVACSPGDPLVLERP 2 +Y + + +CSPGDPLVLERP Sbjct: 38 QYTRKKRSNSCSPGDPLVLERP 59 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIK 570 ILVATD+AARGLD+ G+K Sbjct: 61 ILVATDLAARGLDITGVK 78 Score = 31.1 bits (67), Expect = 0.96 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 371 IIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEG 508 ++F++TK A + + G A +HG+ TQ +R E L +FK G Sbjct: 12 LVFLQTKWMAHKLRIVLGLMGLNADELHGNLTQLQRLEALQKFKNG 57 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.18 Identities = 19/33 (57%), Positives = 23/33 (69%), Gaps = 5/33 (15%) Frame = -2 Query: 85 SASSRTKYV---HRCKLVA--CSPGDPLVLERP 2 SA+ T+Y R +LV+ CSPGDPLVLERP Sbjct: 10 SANIPTRYAILSPRARLVSNSCSPGDPLVLERP 42 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 55 RCKLVACSPGDPLVLERP 2 R K +CSPGDPLVLERP Sbjct: 2 RSKSNSCSPGDPLVLERP 19 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 33.1 bits (72), Expect = 0.24 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 169 DHIKVCLSGRICSMIFLICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 D + C G+ S + I S S+ + T V +CSPGDPLVLERP Sbjct: 477 DDCRACDEGK--SFLSEIPDSPATSSYKDIIESTHIVVTFLSNSCSPGDPLVLERP 530 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSGAHI 66 AAALELVDPPGCR + HI Sbjct: 10 AAALELVDPPGCRNSINTINHI 31 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C +CSPGDPLVLERP Sbjct: 18 CASNSCSPGDPLVLERP 34 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 3 GRSRTSGSPGLQATNLQRCT 62 GRSRTSGSPGLQ + CT Sbjct: 10 GRSRTSGSPGLQEFDASHCT 29 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 52 CKLVACSPGDPLVLERP 2 C +CSPGDPLVLERP Sbjct: 18 CPSNSCSPGDPLVLERP 34 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -2 Query: 73 RTKYVHRCKLVACSPGDPLVLERP 2 R++ + + +CSPGDPLVLERP Sbjct: 56 RSRAIRLSRSNSCSPGDPLVLERP 79 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 121 LICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 L+ G N ++++R ++V R +CSPGDPLVLERP Sbjct: 34 LVSGVN-VASLREDLFSLQHV-RALSNSCSPGDPLVLERP 71 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/19 (78%), Positives = 16/19 (84%), Gaps = 2/19 (10%) Frame = -2 Query: 52 CKLVA--CSPGDPLVLERP 2 C LV+ CSPGDPLVLERP Sbjct: 3 CMLVSNSCSPGDPLVLERP 21 >SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20) Length = 556 Score = 33.1 bits (72), Expect = 0.24 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 ++VAT G+D+ + ++I+F P+ E Y+ IG Sbjct: 314 VVVATCALGMGVDIPDVDHIIHFGIPSEVEHYVQEIG 350 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 115 CGSNPISNIRSASSRTKYVHRCK-LVACSPGDPLVLERP 2 CG +S++ + Y K +CSPGDPLVLERP Sbjct: 20 CGPVALSSLLDEEALLAYSRANKGSNSCSPGDPLVLERP 58 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 79 SSRTKYVHRCKLVACSPGDPLVLERP 2 SSR ++ +CSPGDPLVLERP Sbjct: 53 SSRLRHGSNFLSNSCSPGDPLVLERP 78 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSG 57 AAALELVDPPGCR G Sbjct: 10 AAALELVDPPGCRNSMSQG 28 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -2 Query: 112 GSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 G +P S ++ R +CSPGDPLVLERP Sbjct: 32 GHSPWRREDSINANPHEASRSASNSCSPGDPLVLERP 68 >SB_4445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.7 bits (71), Expect = 0.31 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 538 AARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 A+RGLD+ + +VI D+ + +HR+G Sbjct: 108 ASRGLDIPNVTHVIQLDFATDAAQMLHRVG 137 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.31 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 103 PISNIRSASSRTKYVHRCKLVA--CSPGDPLVLERP 2 P S R+ S H + ++ CSPGDPLVLERP Sbjct: 58 PKSKPRNVSDYPWIDHELRFLSNSCSPGDPLVLERP 93 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 32.7 bits (71), Expect = 0.31 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -2 Query: 178 QVADHIKVCLSGRICSMIFLICGSNPISNIRSASSRTK-YVHRCKLVACSPGDPLVLERP 2 QV ++ SG +I G + R S T+ V + + +CSPGDPLVLERP Sbjct: 73 QVLVALRFYASGSFLQIIGDTFGLPKSTVSRCVSDVTRALVSKAESNSCSPGDPLVLERP 132 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 58 HRCKLVACSPGDPLVLERP 2 +R + +CSPGDPLVLERP Sbjct: 10 YRIQSNSCSPGDPLVLERP 28 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -2 Query: 97 SNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 +NI + T+++ +CSPGDPLVLERP Sbjct: 11 ANILNKIKETRHLQAASN-SCSPGDPLVLERP 41 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 58 HRCKLVACSPGDPLVLERP 2 +R + +CSPGDPLVLERP Sbjct: 319 NRVRSNSCSPGDPLVLERP 337 >SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) Length = 651 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +1 Query: 511 ASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGENWTFKIKRNIICFLYPF 681 + ++VAT G+D +++VI+ + S E+Y G + + + I F PF Sbjct: 353 SQVVVATVAFGMGIDKSNVRFVIHHSFSKSMENYYQESGRAGRDEKRASCIVFYRPF 409 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +2 Query: 359 GAKTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVL 490 G II+ +++ AE ++ + G A C H D + R +V+ Sbjct: 313 GDSGIIYCFSRKDAEQVAIEMSSRGIKAACYHADMPPESRSQVV 356 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/19 (73%), Positives = 16/19 (84%), Gaps = 1/19 (5%) Frame = -2 Query: 55 RCKLV-ACSPGDPLVLERP 2 RC + +CSPGDPLVLERP Sbjct: 11 RCDISNSCSPGDPLVLERP 29 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSGAH 63 AAALELVDPPGCR H Sbjct: 97 AAALELVDPPGCRNSIQQMVH 117 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 118 ICGSNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 +CG S + + R + +CSPGDPLVLERP Sbjct: 23 LCGERGFSGVCVRALRNDVLVIGISNSCSPGDPLVLERP 61 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSG 57 AAALELVDPPGCR G Sbjct: 97 AAALELVDPPGCRNSITGG 115 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 103 PISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 P++ S+ K V + +CSPGDPLVLERP Sbjct: 11 PVAKDSSSPVLLKLVLQGLSNSCSPGDPLVLERP 44 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 55 RCKLVACSPGDPLVLERP 2 R K +CSPGDPLVLERP Sbjct: 9 REKSNSCSPGDPLVLERP 26 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 55 RCKLVACSPGDPLVLERP 2 R + +CSPGDPLVLERP Sbjct: 22 RSRSNSCSPGDPLVLERP 39 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 76 SRTKYVHRCKLVACSPGDPLVLERP 2 S T ++H + +CSPGDPLVLERP Sbjct: 2 SCTYFMHT-RSNSCSPGDPLVLERP 25 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 61 VHRCKLVACSPGDPLVLERP 2 +H KL + PGDPLVLERP Sbjct: 56 LHHSKLSSTGPGDPLVLERP 75 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 2/22 (9%) Frame = -2 Query: 61 VHRCKLVA--CSPGDPLVLERP 2 V R ++++ CSPGDPLVLERP Sbjct: 12 VQRFRIISNSCSPGDPLVLERP 33 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSG 57 AAALELVDPPGCR G Sbjct: 10 AAALELVDPPGCRNSIVLG 28 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +1 Query: 1 AAALELVDPPGCRQPTY 51 AAALELVDPPGCR + Sbjct: 10 AAALELVDPPGCRNSMF 26 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 1 AAALELVDPPGCRQP-TYSGAHI*FLMRL 84 AAALELVDPPGCR T H F M + Sbjct: 67 AAALELVDPPGCRNSITVFHCHTKFRMSI 95 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 109 SNPISNIRSASSRTKYVHRCKLVACSPGDPLVLERP 2 S+ ++ + R++ V +CSPGDPLVLERP Sbjct: 62 SSNVAKVHCRKQRSREVATSN--SCSPGDPLVLERP 95 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +1 Query: 1 AAALELVDPPGCRQPTYSGAH 63 AAALELVDPPGCR + A+ Sbjct: 10 AAALELVDPPGCRNSIAADAN 30 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 67 KYVHRCKLVACSPGDPLVLERP 2 +Y +R +CSPGDPLVLERP Sbjct: 3 RYYYRSN--SCSPGDPLVLERP 22 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 76 SRTKYVHRCKLVACSPGDPLVLERP 2 SR + +CSPGDPLVLERP Sbjct: 4 SRVSIKQQATSNSCSPGDPLVLERP 28 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 61 VHRCKLVA--CSPGDPLVLERP 2 + RC V+ CSPGDPLVLERP Sbjct: 9 IGRCWQVSNSCSPGDPLVLERP 30 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 58 HRCKLVACSPGDPLVLERP 2 H +CSPGDPLVLERP Sbjct: 5 HNVTSNSCSPGDPLVLERP 23 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 3/19 (15%) Frame = -2 Query: 49 KLVA---CSPGDPLVLERP 2 KLVA CSPGDPLVLERP Sbjct: 18 KLVASNSCSPGDPLVLERP 36 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 82 ASSRTKYVHR-CKLVACSPGDPLVLERP 2 A S KY+ + +CSPGDPLVLERP Sbjct: 147 ALSGNKYIKQWIASNSCSPGDPLVLERP 174 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 12 SCSPGDPLVLERP 24 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 37 SCSPGDPLVLERP 49 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 28 SCSPGDPLVLERP 40 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 5 SCSPGDPLVLERP 17 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 20 SCSPGDPLVLERP 32 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 29 SCSPGDPLVLERP 41 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 186 SCSPGDPLVLERP 198 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 81 SCSPGDPLVLERP 93 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 17 SCSPGDPLVLERP 29 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 9 SCSPGDPLVLERP 21 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 8 SCSPGDPLVLERP 20 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 20 SCSPGDPLVLERP 32 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 29 SCSPGDPLVLERP 41 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 13 SCSPGDPLVLERP 25 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 104 SCSPGDPLVLERP 116 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 33 SCSPGDPLVLERP 45 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 9 SCSPGDPLVLERP 21 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 37 SCSPGDPLVLERP 49 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 6 SCSPGDPLVLERP 18 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 384 SCSPGDPLVLERP 396 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 26 SCSPGDPLVLERP 38 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 16 SCSPGDPLVLERP 28 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 24 SCSPGDPLVLERP 36 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 33 SCSPGDPLVLERP 45 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 10 SCSPGDPLVLERP 22 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 24 SCSPGDPLVLERP 36 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 21 SCSPGDPLVLERP 33 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 5 SCSPGDPLVLERP 17 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 9 SCSPGDPLVLERP 21 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 56 SCSPGDPLVLERP 68 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 264 SCSPGDPLVLERP 276 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 21 SCSPGDPLVLERP 33 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 13 SCSPGDPLVLERP 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 13 SCSPGDPLVLERP 25 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 165 SCSPGDPLVLERP 177 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 22 SCSPGDPLVLERP 34 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 23 SCSPGDPLVLERP 35 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 37 SCSPGDPLVLERP 49 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 20 SCSPGDPLVLERP 32 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 66 SCSPGDPLVLERP 78 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 18 SCSPGDPLVLERP 30 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 7 SCSPGDPLVLERP 19 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 6 SCSPGDPLVLERP 18 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 13 SCSPGDPLVLERP 25 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 50 SCSPGDPLVLERP 62 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 15 SCSPGDPLVLERP 27 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 115 SCSPGDPLVLERP 127 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 895 SCSPGDPLVLERP 907 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 16 SCSPGDPLVLERP 28 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 27 SCSPGDPLVLERP 39 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 16 SCSPGDPLVLERP 28 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 45 SCSPGDPLVLERP 57 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 96 SCSPGDPLVLERP 108 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 67 SCSPGDPLVLERP 79 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 17 SCSPGDPLVLERP 29 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 878 SCSPGDPLVLERP 890 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 9 SCSPGDPLVLERP 21 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 13 SCSPGDPLVLERP 25 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 65 SCSPGDPLVLERP 77 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 7 SCSPGDPLVLERP 19 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 517 ILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIG 627 +LV T+ RGLD + +V + P + E+Y+H G Sbjct: 481 LLVGTEETVRGLDFKELDHVYLMEVPKNVEEYLHLCG 517 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 20 SCSPGDPLVLERP 32 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 66 SCSPGDPLVLERP 78 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 45 SCSPGDPLVLERP 57 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 28 SCSPGDPLVLERP 40 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 41 SCSPGDPLVLERP 53 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 17 SCSPGDPLVLERP 29 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 23 SCSPGDPLVLERP 35 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 26 SCSPGDPLVLERP 38 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 43 SCSPGDPLVLERP 55 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 5 SCSPGDPLVLERP 17 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 42 SCSPGDPLVLERP 54 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 27 SCSPGDPLVLERP 39 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 17 SCSPGDPLVLERP 29 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 144 SCSPGDPLVLERP 156 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 485 SCSPGDPLVLERP 497 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 37 SCSPGDPLVLERP 49 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 30 AAALELVDPPGCR 42 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 83 SCSPGDPLVLERP 95 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 38 SCSPGDPLVLERP 50 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 63 SCSPGDPLVLERP 75 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 26 SCSPGDPLVLERP 38 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 6 SCSPGDPLVLERP 18 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 6 SCSPGDPLVLERP 18 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 9 SCSPGDPLVLERP 21 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 25 SCSPGDPLVLERP 37 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 24 SCSPGDPLVLERP 36 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 36 SCSPGDPLVLERP 48 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 206 SCSPGDPLVLERP 218 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 49 SCSPGDPLVLERP 61 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 16 SCSPGDPLVLERP 28 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 4 SCSPGDPLVLERP 16 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 5 SCSPGDPLVLERP 17 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 1024 SCSPGDPLVLERP 1036 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 123 SCSPGDPLVLERP 135 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 6 SCSPGDPLVLERP 18 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 14 SCSPGDPLVLERP 26 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 10 SCSPGDPLVLERP 22 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 65 SCSPGDPLVLERP 77 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 25 SCSPGDPLVLERP 37 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 11 SCSPGDPLVLERP 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 7 SCSPGDPLVLERP 19 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 45 SCSPGDPLVLERP 57 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 26 SCSPGDPLVLERP 38 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 10 AAALELVDPPGCR 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 86 AAALELVDPPGCR 98 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 41 SCSPGDPLVLERP 53 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 24 SCSPGDPLVLERP 36 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 41 SCSPGDPLVLERP 53 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 18 SCSPGDPLVLERP 30 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 AAALELVDPPGCR 39 AAALELVDPPGCR Sbjct: 654 AAALELVDPPGCR 666 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 19 SCSPGDPLVLERP 31 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 62 SCSPGDPLVLERP 74 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 8 SCSPGDPLVLERP 20 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 40 ACSPGDPLVLERP 2 +CSPGDPLVLERP Sbjct: 86 SCSPGDPLVLERP 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,568,731 Number of Sequences: 59808 Number of extensions: 454661 Number of successful extensions: 3526 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3517 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -