BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060054.seq (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 40 0.002 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 40 0.003 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 39 0.004 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 39 0.005 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 38 0.006 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 38 0.008 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 38 0.008 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.011 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 38 0.011 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 38 0.011 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 38 0.011 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 38 0.011 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 37 0.015 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 37 0.015 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 37 0.015 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 37 0.015 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.019 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.019 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.019 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 37 0.019 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 37 0.019 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 37 0.019 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 37 0.019 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 37 0.019 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 37 0.019 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 37 0.019 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 37 0.019 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.025 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.025 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 36 0.025 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.025 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.025 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 36 0.025 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.025 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 36 0.025 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.025 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 36 0.025 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 36 0.025 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 36 0.025 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 36 0.034 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 36 0.034 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.034 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 36 0.034 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.034 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 36 0.034 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 36 0.034 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.034 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 36 0.034 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 36 0.034 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.034 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.034 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 36 0.034 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 36 0.034 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 36 0.034 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.044 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.044 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.044 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.044 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.044 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.044 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.044 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.044 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.044 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.044 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.044 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.044 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.044 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.044 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.044 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.044 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.044 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.044 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.044 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.044 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 36 0.044 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.044 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -2 Query: 97 SVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 SV L L++R LV NSCSPGDPLVLERP Sbjct: 2 SVSLLLISRSRPGRLLVSNSCSPGDPLVLERP 33 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -2 Query: 88 LFLLNRINAHCFLVPNSCSPGDPLVLERP 2 +FL + FL+ NSCSPGDPLVLERP Sbjct: 5 IFLYGFVELISFLISNSCSPGDPLVLERP 33 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 67 NAHCFLVPNSCSPGDPLVLERP 2 +AHC + NSCSPGDPLVLERP Sbjct: 50 DAHCRVPSNSCSPGDPLVLERP 71 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C LV NSCSPGDPLVLERP Sbjct: 3 CMLVSNSCSPGDPLVLERP 21 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 76 NRINAHCFLVPNSCSPGDPLVLERP 2 NRI C+ V NSCSPGDPLVLERP Sbjct: 7 NRIG-RCWQVSNSCSPGDPLVLERP 30 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 +N HC L NSCSPGDPLVLERP Sbjct: 2 VNLHCSL-SNSCSPGDPLVLERP 23 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 79 LNRINAHCFLVPNSCSPGDPLVLERP 2 L N LV NSCSPGDPLVLERP Sbjct: 15 LRNPNTRAHLVSNSCSPGDPLVLERP 40 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 CF NSCSPGDPLVLERP Sbjct: 35 CFYTSNSCSPGDPLVLERP 53 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 +N C+ NSCSPGDPLVLERP Sbjct: 3 LNNLCYKTSNSCSPGDPLVLERP 25 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 88 LFLLNRINAHCFLVPNSCSPGDPLVLERP 2 L + N + F++ NSCSPGDPLVLERP Sbjct: 53 LVITNLLALTVFMLSNSCSPGDPLVLERP 81 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 FL+ NSCSPGDPLVLERP Sbjct: 20 FLISNSCSPGDPLVLERP 37 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 FL+ NSCSPGDPLVLERP Sbjct: 15 FLISNSCSPGDPLVLERP 32 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/21 (85%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = -2 Query: 61 HCFLVP-NSCSPGDPLVLERP 2 H FL+P NSCSPGDPLVLERP Sbjct: 18 HHFLLPSNSCSPGDPLVLERP 38 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 + A F++ NSCSPGDPLVLERP Sbjct: 6 VEAFYFILSNSCSPGDPLVLERP 28 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ F NSCSPGDPLVLERP Sbjct: 9 ISANIFFRSNSCSPGDPLVLERP 31 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -2 Query: 100 YSVMLFLLNRINAHCFL-VPNSCSPGDPLVLERP 2 + ++ +++ IN C V NSCSPGDPLVLERP Sbjct: 16 FIAIIVVVSAINIICICTVSNSCSPGDPLVLERP 49 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/29 (65%), Positives = 21/29 (72%), Gaps = 3/29 (10%) Frame = -2 Query: 79 LNRINAHCFLV---PNSCSPGDPLVLERP 2 L + AH F+V NSCSPGDPLVLERP Sbjct: 1008 LRSMGAHVFVVGLGSNSCSPGDPLVLERP 1036 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C V NSCSPGDPLVLERP Sbjct: 11 CSFVSNSCSPGDPLVLERP 29 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 FL+ NSCSPGDPLVLERP Sbjct: 6 FLLSNSCSPGDPLVLERP 23 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C + NSCSPGDPLVLERP Sbjct: 87 CIVTSNSCSPGDPLVLERP 105 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 +++ C + NSCSPGDPLVLERP Sbjct: 4 LSSLCVFLSNSCSPGDPLVLERP 26 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 +L+ NSCSPGDPLVLERP Sbjct: 7 YLISNSCSPGDPLVLERP 24 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/26 (65%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -2 Query: 76 NRINAHCFLVP-NSCSPGDPLVLERP 2 +R+ H ++P NSCSPGDPLVLERP Sbjct: 56 SRVGHHTPILPSNSCSPGDPLVLERP 81 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS ++ E Sbjct: 10 AAALELVDPPGCRNSIKDKGE 30 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C+ + NSCSPGDPLVLERP Sbjct: 7 CYELSNSCSPGDPLVLERP 25 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS +N+ Sbjct: 654 AAALELVDPPGCRNSISSSNQ 674 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F + NSCSPGDPLVLERP Sbjct: 45 FFISNSCSPGDPLVLERP 62 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -2 Query: 97 SVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 SV LF+ NR+ + NSCSPGDPLVLERP Sbjct: 44 SVTLFIENRL-----MRSNSCSPGDPLVLERP 70 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F++ NSCSPGDPLVLERP Sbjct: 103 FILSNSCSPGDPLVLERP 120 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C V NSCSPGDPLVLERP Sbjct: 5 CEAVSNSCSPGDPLVLERP 23 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C NSCSPGDPLVLERP Sbjct: 2 CIFASNSCSPGDPLVLERP 20 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H ++ NSCSPGDPLVLERP Sbjct: 22 HNIVISNSCSPGDPLVLERP 41 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 LV NSCSPGDPLVLERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ FL NSCSPGDPLVLERP Sbjct: 9 ISANIFL-SNSCSPGDPLVLERP 30 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 FL NSCSPGDPLVLERP Sbjct: 6 FLPSNSCSPGDPLVLERP 23 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F V NSCSPGDPLVLERP Sbjct: 32 FKVSNSCSPGDPLVLERP 49 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ + NSCSPGDPLVLERP Sbjct: 9 ISANIVHISNSCSPGDPLVLERP 31 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F V NSCSPGDPLVLERP Sbjct: 30 FRVSNSCSPGDPLVLERP 47 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 LV NSCSPGDPLVLERP Sbjct: 9 LVSNSCSPGDPLVLERP 25 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 LV NSCSPGDPLVLERP Sbjct: 2 LVSNSCSPGDPLVLERP 18 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 85 FLLNRINAHCFLVPNSCSPGDPLVLERP 2 FL N A NSCSPGDPLVLERP Sbjct: 15 FLCNEDLARTCFSSNSCSPGDPLVLERP 42 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H L NSCSPGDPLVLERP Sbjct: 34 HRVLTSNSCSPGDPLVLERP 53 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 + AH NSCSPGDPLVLERP Sbjct: 15 VGAHNMAGSNSCSPGDPLVLERP 37 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANICFTSNSCSPGDPLVLERP 31 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 1 AAALELVDPPGCRNSAREN 57 AAALELVDPPGCRNS +N Sbjct: 10 AAALELVDPPGCRNSIGQN 28 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNEH 66 AAALELVDPPGCRNS + H Sbjct: 30 AAALELVDPPGCRNSMPDRPRH 51 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 37 LISNSCSPGDPLVLERP 53 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 76 NRINAHCFLVPNSCSPGDPLVLERP 2 +R N + NSCSPGDPLVLERP Sbjct: 41 SRPNEEWIFLSNSCSPGDPLVLERP 65 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -2 Query: 103 NYSVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 N + L NA L NSCSPGDPLVLERP Sbjct: 17 NKNTTFSTLKTKNAPLKLSSNSCSPGDPLVLERP 50 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS N++ Sbjct: 10 AAALELVDPPGCRNSMDPNDQ 30 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 103 NYSVMLFLLNRINAHCF-LVPNSCSPGDPLVLERP 2 NY+ LF+ N C NSCSPGDPLVLERP Sbjct: 2 NYN-SLFVREGANISCGRFASNSCSPGDPLVLERP 35 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F + NSCSPGDPLVLERP Sbjct: 30 FSISNSCSPGDPLVLERP 47 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 +N +V NSCSPGDPLVLERP Sbjct: 1 MNMMIVVVSNSCSPGDPLVLERP 23 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 24 LISNSCSPGDPLVLERP 40 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 82 LLNRINA--HCFLVPNSCSPGDPLVLERP 2 +LN+I H NSCSPGDPLVLERP Sbjct: 13 ILNKIKETRHLQAASNSCSPGDPLVLERP 41 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/31 (61%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 85 FLLNRINAHCFLVP---NSCSPGDPLVLERP 2 F L R+ A F+ NSCSPGDPLVLERP Sbjct: 57 FFLARVKAANFVTATESNSCSPGDPLVLERP 87 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H L NSCSPGDPLVLERP Sbjct: 3 HVSLSSNSCSPGDPLVLERP 22 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 70 LISNSCSPGDPLVLERP 86 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 94 VMLFLLNRINAHC--FLVPNSCSPGDPLVLERP 2 V+ + L+ C F+ NSCSPGDPLVLERP Sbjct: 50 VLAWALHTFGFFCYSFIGSNSCSPGDPLVLERP 82 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 64 AHCFLVPNSCSPGDPLVLERP 2 A CF NSCSPGDPLVLERP Sbjct: 7 ASCF-ASNSCSPGDPLVLERP 26 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 34 LISNSCSPGDPLVLERP 50 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 67 NAHCFL-VPNSCSPGDPLVLERP 2 +A C + + NSCSPGDPLVLERP Sbjct: 83 SAECVMTISNSCSPGDPLVLERP 105 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 +L NSCSPGDPLVLERP Sbjct: 10 YLASNSCSPGDPLVLERP 27 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 +C+ V NSCSPGDPLVLERP Sbjct: 24 YCY-VSNSCSPGDPLVLERP 42 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 31 LISNSCSPGDPLVLERP 47 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 347 IVSNSCSPGDPLVLERP 363 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 56 FSRAEFLQPGGSTSSRAA 3 FSR EFLQPGGSTSSRAA Sbjct: 48 FSRIEFLQPGGSTSSRAA 65 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 79 LNRINAHCFLVPNSCSPGDPLVLERP 2 + NA F V NSCSPGDPLVLERP Sbjct: 1 MRNYNAVLF-VSNSCSPGDPLVLERP 25 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSAR 51 AAALELVDPPGCRNS R Sbjct: 10 AAALELVDPPGCRNSIR 26 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 3 GRSRTSGSPGLQEFGTRKQ 59 GRSRTSGSPGLQEF T+ Q Sbjct: 10 GRSRTSGSPGLQEFDTKNQ 28 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 1 AAALELVDPPGCRNSARE 54 AAALELVDPPGCRNS E Sbjct: 10 AAALELVDPPGCRNSIHE 27 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 77 IVSNSCSPGDPLVLERP 93 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENN 60 AAALELVDPPGCRNS + N Sbjct: 10 AAALELVDPPGCRNSIEDFN 29 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS + E Sbjct: 10 AAALELVDPPGCRNSIKYGQE 30 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 11 MVSNSCSPGDPLVLERP 27 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 103 NYS-VMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 NY V+L + + + NSCSPGDPLVLERP Sbjct: 13 NYKHVLLDRHEHVTICSYRISNSCSPGDPLVLERP 47 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSAR 51 AAALELVDPPGCRNS R Sbjct: 10 AAALELVDPPGCRNSIR 26 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +1 Query: 1 AAALELVDPPGCRNSAREN 57 AAALELVDPPGCRNS N Sbjct: 10 AAALELVDPPGCRNSMNAN 28 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANILHASNSCSPGDPLVLERP 31 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F V NSCSPGDPLVLERP Sbjct: 28 FGVSNSCSPGDPLVLERP 45 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 76 NRINAHCFLVPNSCSPGDPLVLERP 2 +++N NSCSPGDPLVLERP Sbjct: 30 SKLNKTAIKASNSCSPGDPLVLERP 54 >SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 CF +SCSPGDPLVLERP Sbjct: 2 CFTHAHSCSPGDPLVLERP 20 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 85 IVSNSCSPGDPLVLERP 101 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 13 IVSNSCSPGDPLVLERP 29 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 6 IVSNSCSPGDPLVLERP 22 >SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -1 Query: 92 NVISIEQN*CSLFSRAEFLQPGGSTSSRAA 3 N++SIE S EFLQPGGSTSSRAA Sbjct: 12 NIVSIEHTEHKRCSCIEFLQPGGSTSSRAA 41 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.011 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 + + NSCSPGDPLVLERP Sbjct: 5 YFISNSCSPGDPLVLERP 22 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -2 Query: 94 VMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 + L+L++ ++ V NSCSPGDPLVLERP Sbjct: 3 IQLYLVS-VDKIADFVSNSCSPGDPLVLERP 32 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 + F NSCSPGDPLVLERP Sbjct: 4 YIFYASNSCSPGDPLVLERP 23 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = -2 Query: 97 SVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 S + LL + L NSCSPGDPLVLERP Sbjct: 10 SANILLLKNVVWLQLLPSNSCSPGDPLVLERP 41 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 82 LLNRINAHCFLVPNSCSPGDPLVLERP 2 L N N+H NSCSPGDPLVLERP Sbjct: 5 LCNIANSH---TSNSCSPGDPLVLERP 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 17 IISNSCSPGDPLVLERP 33 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C NSCSPGDPLVLERP Sbjct: 10 CVTSSNSCSPGDPLVLERP 28 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -2 Query: 103 NYSVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 +++ L N HC NSCSPGDPLVLERP Sbjct: 3 HFTDTLISANIKGRHC--ASNSCSPGDPLVLERP 34 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 62 LLSNSCSPGDPLVLERP 78 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS + + Sbjct: 10 AAALELVDPPGCRNSIKRTQQ 30 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 119 IISNSCSPGDPLVLERP 135 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 73 RINAHCFLVPNSCSPGDPLVLERP 2 R+ + C NSCSPGDPLVLERP Sbjct: 21 RVASLCRSRSNSCSPGDPLVLERP 44 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/24 (66%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = -2 Query: 70 INAHCFLVP-NSCSPGDPLVLERP 2 +N++ ++V NSCSPGDPLVLERP Sbjct: 4 VNSNFWIVTSNSCSPGDPLVLERP 27 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSARE 54 AAALELVDPPGCRNS ++ Sbjct: 10 AAALELVDPPGCRNSMKQ 27 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 67 NAHCFLVPNSCSPGDPLVLERP 2 N++ NSCSPGDPLVLERP Sbjct: 19 NSNSHTASNSCSPGDPLVLERP 40 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 67 NAHCFLVPNSCSPGDPLVLERP 2 NA L NSCSPGDPLVLERP Sbjct: 9 NASRTLRSNSCSPGDPLVLERP 30 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 +C + NSCSPGDPLVLERP Sbjct: 156 NCEVGSNSCSPGDPLVLERP 175 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 3474 VVSNSCSPGDPLVLERP 3490 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 14 IISNSCSPGDPLVLERP 30 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 13 IISNSCSPGDPLVLERP 29 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 54 LLSNSCSPGDPLVLERP 70 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 2 LLSNSCSPGDPLVLERP 18 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 6 LLSNSCSPGDPLVLERP 22 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 19 VVSNSCSPGDPLVLERP 35 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 5 IISNSCSPGDPLVLERP 21 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F+ NSCSPGDPLVLERP Sbjct: 11 FVPSNSCSPGDPLVLERP 28 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 +N + V NSCSPGDPLVLERP Sbjct: 11 MNFNHLKVSNSCSPGDPLVLERP 33 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 73 RINAHCFLVPNSCSPGDPLVLERP 2 R+ V NSCSPGDPLVLERP Sbjct: 24 RVKEGKIAVSNSCSPGDPLVLERP 47 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 1 MISNSCSPGDPLVLERP 17 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 64 AHCFLVPNSCSPGDPLVLERP 2 ++ L NSCSPGDPLVLERP Sbjct: 84 SNLLLTSNSCSPGDPLVLERP 104 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L+ NSCSPGDPLVLERP Sbjct: 1 LLSNSCSPGDPLVLERP 17 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 4 IISNSCSPGDPLVLERP 20 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/18 (94%), Positives = 17/18 (94%), Gaps = 1/18 (5%) Frame = -2 Query: 52 LVP-NSCSPGDPLVLERP 2 LVP NSCSPGDPLVLERP Sbjct: 27 LVPSNSCSPGDPLVLERP 44 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 73 RINAHCFLVPNSCSPGDPLVLERP 2 R+NA V NSCSPGDPLVLERP Sbjct: 19 RVNA----VSNSCSPGDPLVLERP 38 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANILAGSNSCSPGDPLVLERP 31 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 +V NSCSPGDPLVLERP Sbjct: 27 VVSNSCSPGDPLVLERP 43 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 13 IISNSCSPGDPLVLERP 29 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 26 IISNSCSPGDPLVLERP 42 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F + NSCSPGDPLVLERP Sbjct: 2 FGISNSCSPGDPLVLERP 19 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -2 Query: 58 CFL-VPNSCSPGDPLVLERP 2 C L + NSCSPGDPLVLERP Sbjct: 8 CLLEISNSCSPGDPLVLERP 27 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANISQTSNSCSPGDPLVLERP 31 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 2 VSNSCSPGDPLVLERP 17 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 15 LTSNSCSPGDPLVLERP 31 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANIGKTSNSCSPGDPLVLERP 31 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 40 VSNSCSPGDPLVLERP 55 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 117 VSNSCSPGDPLVLERP 132 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 184 VSNSCSPGDPLVLERP 199 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 + H NSCSPGDPLVLERP Sbjct: 7 VTIHVLNSSNSCSPGDPLVLERP 29 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 1066 VSNSCSPGDPLVLERP 1081 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 14 VISNSCSPGDPLVLERP 30 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 78 LTSNSCSPGDPLVLERP 94 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNE 63 AAALELVDPPGCRNS + + + Sbjct: 10 AAALELVDPPGCRNSIKVHKD 30 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 214 VSNSCSPGDPLVLERP 229 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 5 LASNSCSPGDPLVLERP 21 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 67 NAHCFLVPNSCSPGDPLVLERP 2 N+ + NSCSPGDPLVLERP Sbjct: 146 NSRLEKISNSCSPGDPLVLERP 167 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 5 VSNSCSPGDPLVLERP 20 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 65 CSLFSRAEFLQPGGSTSSRAA 3 C LF EFLQPGGSTSSRAA Sbjct: 45 CLLFRFIEFLQPGGSTSSRAA 65 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 64 VSNSCSPGDPLVLERP 79 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H NSCSPGDPLVLERP Sbjct: 24 HVKFTSNSCSPGDPLVLERP 43 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 6 LASNSCSPGDPLVLERP 22 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 19 VSNSCSPGDPLVLERP 34 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F NSCSPGDPLVLERP Sbjct: 15 FFQSNSCSPGDPLVLERP 32 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -2 Query: 94 VMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 +M + I H NSCSPGDPLVLERP Sbjct: 96 MMTMVSRNIPDHYSSPSNSCSPGDPLVLERP 126 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 11 VSNSCSPGDPLVLERP 26 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H NSCSPGDPLVLERP Sbjct: 10 HIHRASNSCSPGDPLVLERP 29 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 25 VSNSCSPGDPLVLERP 40 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 17 LASNSCSPGDPLVLERP 33 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 61 HCFLVPNSCSPGDPLVLERP 2 H + NSCSPGDPLVLERP Sbjct: 52 HVRALSNSCSPGDPLVLERP 71 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 59 VSNSCSPGDPLVLERP 74 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 70 INAHCFLVP-NSCSPGDPLVLERP 2 I A + +P NSCSPGDPLVLERP Sbjct: 27 IQAKPYNIPSNSCSPGDPLVLERP 50 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 31 VSNSCSPGDPLVLERP 46 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 F + NSCSPGDPLVLERP Sbjct: 59 FELSNSCSPGDPLVLERP 76 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 41 VSNSCSPGDPLVLERP 56 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 ++ + + NSCSPGDPLVLERP Sbjct: 6 LDRESYALSNSCSPGDPLVLERP 28 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 6 VSNSCSPGDPLVLERP 21 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 5 VISNSCSPGDPLVLERP 21 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C + NSCSPGDPLVLERP Sbjct: 12 CGELSNSCSPGDPLVLERP 30 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 20 LASNSCSPGDPLVLERP 36 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 82 LLNRINAHCFLVPNSCSPGDPLVLERP 2 L+ I + NSCSPGDPLVLERP Sbjct: 105 LIPSIKRRLLGISNSCSPGDPLVLERP 131 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 67 NAHCFLVPNSCSPGDPLVLERP 2 N C + NSCSPGDPLVLERP Sbjct: 9 NVRCD-ISNSCSPGDPLVLERP 29 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 17 VSNSCSPGDPLVLERP 32 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 14 VSNSCSPGDPLVLERP 29 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 17 VISNSCSPGDPLVLERP 33 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 3 LASNSCSPGDPLVLERP 19 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 15 LTSNSCSPGDPLVLERP 31 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENN 60 AAALELVDPPGCRNS N Sbjct: 86 AAALELVDPPGCRNSIAGKN 105 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSARE 54 AAALELVDPPGCRNS ++ Sbjct: 97 AAALELVDPPGCRNSIQQ 114 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 661 LASNSCSPGDPLVLERP 677 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 7 LASNSCSPGDPLVLERP 23 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 193 VSNSCSPGDPLVLERP 208 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.7 bits (81), Expect = 0.019 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 49 YVTSNSCSPGDPLVLERP 66 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 9 VSNSCSPGDPLVLERP 24 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 96 LASNSCSPGDPLVLERP 112 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 L NSCSPGDPLVLERP Sbjct: 4 LASNSCSPGDPLVLERP 20 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -2 Query: 103 NYSVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 N S+ + RI + NSCSPGDPLVLERP Sbjct: 518 NSSLEVLYFWRIKSFFGNASNSCSPGDPLVLERP 551 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 101 ISNSCSPGDPLVLERP 116 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 261 ISNSCSPGDPLVLERP 276 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.025 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = -2 Query: 100 YSVMLFLLNRINAHCFLVPNSCSPGDPLVLERP 2 YSV L + NSCSPGDPLVLERP Sbjct: 3 YSVTLMCRASRKTRKKIPSNSCSPGDPLVLERP 35 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 16 ISNSCSPGDPLVLERP 31 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENN 60 AAALELVDPPGCRNS N Sbjct: 10 AAALELVDPPGCRNSINTIN 29 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 55 FLVPNSCSPGDPLVLERP 2 +++ NSCSPGDPLVLERP Sbjct: 91 WVLSNSCSPGDPLVLERP 108 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 13 ILSNSCSPGDPLVLERP 29 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENN 60 AAALELVDPPGCRNS N+ Sbjct: 10 AAALELVDPPGCRNSIDIND 29 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 3 GRSRTSGSPGLQEFGTRK 56 GRSRTSGSPGLQEF RK Sbjct: 10 GRSRTSGSPGLQEFDMRK 27 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSAR 51 AAALELVDPPGCRNS + Sbjct: 10 AAALELVDPPGCRNSMK 26 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 36.3 bits (80), Expect = 0.025 Identities = 20/43 (46%), Positives = 23/43 (53%) Frame = +1 Query: 1 AAALELVDPPGCRNSARENNEH*FCSIEITLQSNYLKNTYNLI 129 AAALELVDPPGCRNS N + T Q+ Y L+ Sbjct: 86 AAALELVDPPGCRNSMIYENYILLRKLHSTAQTTLYFANYILL 128 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 59 ISNSCSPGDPLVLERP 74 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 9 ISNSCSPGDPLVLERP 24 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 3 ISNSCSPGDPLVLERP 18 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 61 HCFLVP--NSCSPGDPLVLERP 2 H L P NSCSPGDPLVLERP Sbjct: 15 HELLAPTSNSCSPGDPLVLERP 36 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 52 LVPNSCSPGDPLVLERP 2 ++ NSCSPGDPLVLERP Sbjct: 55 ILSNSCSPGDPLVLERP 71 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 13 ISNSCSPGDPLVLERP 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 52 ISNSCSPGDPLVLERP 67 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 51 ISNSCSPGDPLVLERP 66 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 1 AAALELVDPPGCRNSAREN 57 AAALELVDPPGCRNS ++ Sbjct: 27 AAALELVDPPGCRNSIMDS 45 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 70 INAHCFLVPNSCSPGDPLVLERP 2 I+A+ NSCSPGDPLVLERP Sbjct: 9 ISANIKFRSNSCSPGDPLVLERP 31 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 1 AAALELVDPPGCRNSAR 51 AAALELVDPPGCRNS + Sbjct: 65 AAALELVDPPGCRNSMK 81 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 7 ISNSCSPGDPLVLERP 22 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 58 CFLVPNSCSPGDPLVLERP 2 C NSCSPGDPLVLERP Sbjct: 3 CASSSNSCSPGDPLVLERP 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +1 Query: 1 AAALELVDPPGCRNSAREN 57 AAALELVDPPGCRNS N Sbjct: 27 AAALELVDPPGCRNSIDGN 45 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/28 (57%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -2 Query: 79 LNRINAHCFLVP--NSCSPGDPLVLERP 2 L+++ + F++ NSCSPGDPLVLERP Sbjct: 50 LSKLPNNLFIITTSNSCSPGDPLVLERP 77 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 18 ISNSCSPGDPLVLERP 33 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 974 ISNSCSPGDPLVLERP 989 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 49 VPNSCSPGDPLVLERP 2 + NSCSPGDPLVLERP Sbjct: 6 ISNSCSPGDPLVLERP 21 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,827,057 Number of Sequences: 59808 Number of extensions: 477096 Number of successful extensions: 3130 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3130 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -