BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060052.seq (681 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37338| Best HMM Match : FMO-like (HMM E-Value=2.1e-21) 34 0.093 SB_25416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_37338| Best HMM Match : FMO-like (HMM E-Value=2.1e-21) Length = 433 Score = 34.3 bits (75), Expect = 0.093 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = +2 Query: 17 AEYAALLASGKLKLPSQEEMLNSWLKHISSLQVKGMKIIDLNVVGSEMDQYFGNLTEEAG 196 +EY + +GK+KLPS EEM S K + + +GM + +G + Y + + A Sbjct: 323 SEYIISMLTGKVKLPSAEEMHQSAEKEYNEVISEGMAEKYAHFLGPKQWSYNDKIADSAQ 382 Query: 197 VVRAPPVL 220 R P++ Sbjct: 383 CSRLSPMV 390 >SB_25416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 35 LASGKLKLPSQEEMLNS--WLKHISSL-QVKGMKIIDLNVVGSEMDQYFGNLTEEAGVVR 205 L SG + S E++ S W + + L Q K L+V E+++YF +L E + Sbjct: 148 LVSGYRRNLSTGEVIGSAKWWRRVDCLSQRKSHSPCQLSVQAQELNKYFKDLCWEKEYSK 207 Query: 206 APPV 217 PPV Sbjct: 208 PPPV 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,872,993 Number of Sequences: 59808 Number of extensions: 357768 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -