BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060052.seq (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 25 2.2 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 25 2.2 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 25 2.2 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 25 2.2 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 25 2.2 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 25 2.2 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.2 DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. 25 2.9 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 24 3.9 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 81 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 110 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 81 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 110 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 80 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 109 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 80 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 109 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 80 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 109 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 80 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 109 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 152 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 181 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 155 EMDQYFGNLTEEAGVVRAPPVLTAIRDFNGV 247 E D+ G A ++R P V T ++DFNG+ Sbjct: 151 EEDRLIGETAPAAKLIRQP-VHTLLKDFNGL 180 >DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. Length = 153 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 157 NGSIFRQFN*RSWCGESAPGTHSDQ 231 N IF Q N ++WC E G H D+ Sbjct: 81 NYGIF-QINSKTWCREGRKGGHCDK 104 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 113 PVGKRCVSAKNSTFPPVMEASIYPK 39 P +C + +NS FP + AS P+ Sbjct: 231 PTASQCKTGRNSKFPGLCNASEEPR 255 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,896 Number of Sequences: 2352 Number of extensions: 13874 Number of successful extensions: 24 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -