BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021957 (614 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 5.9 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 5.9 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +1 Query: 373 NRSLEHNYTREILRLMTTLSVPSTRTLVPDATRSYFCHQQQRFPSRGDACAPEYPGTA-S 549 N L ++ ++ + + +T++ +T ++P + QQQ+ + A GTA S Sbjct: 1050 NGMLCNSLSQRVSTITSTMAAAATPLMMPSVITTSVGQQQQQQRTAATGSAGPVAGTARS 1109 Query: 550 CKSAG 564 K AG Sbjct: 1110 EKDAG 1114 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 469 AWHPVQECE*TVQIKWSLISISHEYNYVPKNGSTELCQE 353 A +PV+ + ++ S+ + +H+Y + PK S L E Sbjct: 289 AGYPVRPFDFSIPGVTSISADTHKYGFTPKGSSVILYSE 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,522 Number of Sequences: 2352 Number of extensions: 13369 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -