BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021957 (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 25 0.78 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.6 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 24.6 bits (51), Expect = 0.78 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 388 HNYTREILRLMTTLSVPSTRTLVPDATRSYFCHQQQRF 501 H+Y+R+ R +TT +V +T ++ + Y Q F Sbjct: 329 HDYSRQFPRDLTTQTVSTTADVLQEEEEEYSPSVQHEF 366 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 334 HLRSRMSPGIIPWNRSLEHNYTREILRLMTT 426 H RS + + PW R + N+ +L + T Sbjct: 337 HFRSPSTHNMSPWVRQVFLNWMPRLLMMRRT 367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,960 Number of Sequences: 438 Number of extensions: 3349 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -