BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021957 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06840.1 68416.m00811 expressed protein 28 4.3 At5g40540.1 68418.m04920 protein kinase, putative similar to pro... 28 5.7 >At3g06840.1 68416.m00811 expressed protein Length = 187 Score = 28.3 bits (60), Expect = 4.3 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -1 Query: 245 MRMIAPVFSTSTSRHFSKARGFIPLLILSTRSEVV*KKQRE 123 M I+P+FS S S+HFS GF P L E K +RE Sbjct: 1 MSNISPIFSISNSQHFSD-YGFDPQLHYFQVMEEARKHKRE 40 >At5g40540.1 68418.m04920 protein kinase, putative similar to protein kinase ATN1 [Arabidopsis thaliana] gi|1054633|emb|CAA63387 Length = 353 Score = 27.9 bits (59), Expect = 5.7 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +1 Query: 391 NYTREILRLMTTLSVPSTRTLVPDATRSYFCHQQQRFPSRGDACAPEYPGTAS 549 N+T I L+ LS S+ LVP A + F + P PE PGT S Sbjct: 278 NFTEIIQMLLRCLSTISSTELVPPAIKRVFSSENTVLP-------PESPGTCS 323 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,905,485 Number of Sequences: 28952 Number of extensions: 253868 Number of successful extensions: 582 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -