BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV021956
(692 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical ... 29 4.2
>AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical
protein T05C3.2 protein.
Length = 1733
Score = 28.7 bits (61), Expect = 4.2
Identities = 17/62 (27%), Positives = 32/62 (51%)
Frame = +2
Query: 113 IERETMLNYSVRQTNRSHVYQIVTLISSTTHCRPR*DSL*TSTNLCHLKKQTPFKFINIS 292
++RE M NY + T R V+ I+ + + HC + N+ + +T KF++I+
Sbjct: 284 LDREAMHNYFMSVTEREVVHGILKVKNPNEHCLCYIRHI---NNIALSQMKTASKFVDIA 340
Query: 293 YN 298
+N
Sbjct: 341 HN 342
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,527,462
Number of Sequences: 27780
Number of extensions: 251568
Number of successful extensions: 543
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 543
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1592382278
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -