BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021952 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 24 3.9 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 5.2 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.2 bits (50), Expect = 3.9 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +1 Query: 547 CQSTNNEAGCHSPSRIAHSI 606 C NN+ CH ++HS+ Sbjct: 24 CDLDNNKTNCHCARNLSHSL 43 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.8 bits (49), Expect = 5.2 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 88 IFLGIKVKPGPIERHKLENFGLENTVDSLRTEAEKRSNVPSSSLXLIH 231 IFL ++ ERH L + E ++RT AEK+ + ++ L H Sbjct: 13 IFLVLRYIYSHWERHGLPHLKPEIPYGNIRTVAEKKESFGTAINNLYH 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,577 Number of Sequences: 2352 Number of extensions: 14373 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -