BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021944 (642 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00052-2|AAK95881.1| 404|Caenorhabditis elegans Hypothetical pr... 28 6.5 Z75713-9|CAB00053.1| 235|Caenorhabditis elegans Hypothetical pr... 27 8.6 Z75713-8|CAB00056.1| 234|Caenorhabditis elegans Hypothetical pr... 27 8.6 M73827-1|AAA27983.1| 234|Caenorhabditis elegans casein kinase I... 27 8.6 >U00052-2|AAK95881.1| 404|Caenorhabditis elegans Hypothetical protein K02F3.6 protein. Length = 404 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 138 IKCLNYYFKIKSFVCEVVTNSRN 206 I+CLN + K K FVC N N Sbjct: 8 IQCLNKFSKYKKFVCHTTCNCPN 30 >Z75713-9|CAB00053.1| 235|Caenorhabditis elegans Hypothetical protein T01G9.6b protein. Length = 235 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -2 Query: 479 FSPHPKLR*RRPVSKLVLPTLRVAAYRSVAHGAQ 378 F HP LR RRPV++ V P L VA+G Q Sbjct: 168 FFVHPDLRPRRPVTQFV-PKLYGFKIHPVAYGGQ 200 >Z75713-8|CAB00056.1| 234|Caenorhabditis elegans Hypothetical protein T01G9.6a protein. Length = 234 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -2 Query: 479 FSPHPKLR*RRPVSKLVLPTLRVAAYRSVAHGAQ 378 F HP LR RRPV++ V P L VA+G Q Sbjct: 167 FFVHPDLRPRRPVTQFV-PKLYGFKIHPVAYGGQ 199 >M73827-1|AAA27983.1| 234|Caenorhabditis elegans casein kinase II beta subunit protein. Length = 234 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -2 Query: 479 FSPHPKLR*RRPVSKLVLPTLRVAAYRSVAHGAQ 378 F HP LR RRPV++ V P L VA+G Q Sbjct: 167 FFVHPDLRPRRPVTQFV-PKLYGFKIHPVAYGGQ 199 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,986,186 Number of Sequences: 27780 Number of extensions: 285287 Number of successful extensions: 719 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -