BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021941 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 27 0.22 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.7 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 26.6 bits (56), Expect = 0.22 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 442 GGKFRKSSKSTGQT*KYKNNVFNNEAKLRRLSIEGELLKRNPVIQII 582 GGK + SK K K + N + R L E +L+KR+P++ I+ Sbjct: 111 GGKHKFISK------KIKKTMENKDITKRPLPNESQLIKRHPIVTIM 151 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 350 NVQNNPKQIENKQETDRDNREGKNVGSKIEPEASSASHQKVPDKPEN 490 N QN+ +Q +NKQ +R N + K G++ + + Q + +N Sbjct: 458 NRQNDNRQNDNKQNGNRQN-DNKQNGNRQNDNKQNGNRQNGNKQNDN 503 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 347 NNVQNNPKQIENKQETDRDNREGKN 421 +N QN+ KQ N+Q ++ N +N Sbjct: 462 DNRQNDNKQNGNRQNDNKQNGNRQN 486 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 629 NVQIIFYTSSRRYYG 585 N IFYT+S++YYG Sbjct: 198 NSSEIFYTTSQQYYG 212 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 260 GNSTTGMVIQNRFQMRMTKFTEMYRIH 180 G+ T G V Q + + RM K+ ++ IH Sbjct: 1078 GSWTAGTVSQQKQKRRMVKYGKLVMIH 1104 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/43 (20%), Positives = 25/43 (58%) Frame = +1 Query: 292 IDH*TARSYNRKGILCSSEQCTKQPKTN*EQTRNRQGQPRREK 420 +DH + ++ ++ +Q +QP+ +Q + +Q QP++++ Sbjct: 1493 VDHSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQQQPQPQQQQ 1535 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 521 LASLLKTLFLYFQVCPVLFDDLRNLPP 441 L SLL +Y VC + + ++ LPP Sbjct: 466 LGSLLNPSHMYRAVCGRIENTIQGLPP 492 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,446 Number of Sequences: 438 Number of extensions: 5074 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -