BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021937X (434 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 0.94 SPBC1685.13 |||non classical export pathway protein |Schizosacch... 25 5.0 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 25 5.0 SPCC1450.02 ||SPCC191.13|bromodomain protein|Schizosaccharomyces... 24 8.8 SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 ... 24 8.8 SPCC16C4.15 |rml2||mitochondrial ribosomal protein subunit L2|Sc... 24 8.8 SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosacc... 24 8.8 SPCC970.03 |||cytochrome b5 reductase |Schizosaccharomyces pombe... 24 8.8 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 27.5 bits (58), Expect = 0.94 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 163 SNCFANESTTGSESRPAEKIRRETQRADAW 252 S+C +ES ES PA K E D+W Sbjct: 299 SSCLLDESMVTGESVPARKFPLEDNSLDSW 328 >SPBC1685.13 |||non classical export pathway protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 183 Score = 25.0 bits (52), Expect = 5.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 357 WI*SFRKDVSWALTVTGSCMIRI 425 W+ +F V+W +TG C I + Sbjct: 76 WLIAFYDFVNWVFALTGGCCIAV 98 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 25.0 bits (52), Expect = 5.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 49 PKPFQFHQDRWASKGSAKR 105 P+P F+ DRWA G A++ Sbjct: 426 PEPETFNPDRWAPNGLAEQ 444 >SPCC1450.02 ||SPCC191.13|bromodomain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 578 Score = 24.2 bits (50), Expect = 8.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 196 SESRPAEKIRRETQRADAWGG 258 SE+ AEKIRR Q+ D + G Sbjct: 528 SETEQAEKIRRLQQQLDRFAG 548 >SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.2 bits (50), Expect = 8.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 413 AGAGHRQRPRHVLAERSDPVTFALDAFSSNTRGRLRAPV 297 AGA H+ A DP T + A S + R +L+ P+ Sbjct: 171 AGASHKHGEIGCAAAIYDPTTDTVLAVSVDERSKLKNPI 209 >SPCC16C4.15 |rml2||mitochondrial ribosomal protein subunit L2|Schizosaccharomyces pombe|chr 3|||Manual Length = 318 Score = 24.2 bits (50), Expect = 8.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 416 HAGAGHRQRPRHVLAERSDP 357 H G GH+QR R V ER P Sbjct: 61 HQGGGHKQRIRLVDFERKVP 80 >SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 24.2 bits (50), Expect = 8.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 335 FSSNTRGRLRAPVTVLDELDKEVDVQPPHASAR 237 ++S R+RA T+L +LD E +P + R Sbjct: 463 YASEITARMRAAATMLSQLDAEGSRRPKAETER 495 >SPCC970.03 |||cytochrome b5 reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 301 Score = 24.2 bits (50), Expect = 8.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 147 SPSEALGQLLANPTPLG*AFARPPVLVKLERLRATSKL 34 +PS L+ PTP+ + V + E+ RA SKL Sbjct: 257 APSPETKVLICGPTPMVNSLREATVALGYEKSRAISKL 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,477,741 Number of Sequences: 5004 Number of extensions: 24050 Number of successful extensions: 74 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -