BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021934 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 7.1 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 9.3 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 9.3 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 425 REIHNTFAFRIYIVTSI 375 REI+ FAF++ + TS+ Sbjct: 148 REINGIFAFQVLMCTSM 164 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 99 LQNEELKLHLRYQNQVQPYKKKDL 170 L+ E ++ + +QN+ YKK+DL Sbjct: 154 LRLSEKQVKIWFQNRRVKYKKEDL 177 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = -3 Query: 144 LDFDIXDVILVLRFVTSVMSCWLFLMKANLYRTTFFFFEVDQ 19 +DF + ILV W F+ + +T F F + Q Sbjct: 81 IDFSLCKAILVHAITIRSTFSWTFIDVFIMLTSTAFVFRLKQ 122 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,848 Number of Sequences: 336 Number of extensions: 2615 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -