BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021933 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.2 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 4.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.5 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.3 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.6 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 403 FCSELTCVFIKGNYLYFVVVFLNK 332 FC + C+ + GN + +V+F K Sbjct: 74 FCIIIMCLGVIGNVMVPIVIFKTK 97 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 403 FCSELTCVFIKGNYLYFVVVFLNK 332 FC + C+ + GN + +V+F K Sbjct: 74 FCIIIMCLGVIGNVMVPIVIFKTK 97 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 467 YPDLLATSGDYLRIGVPESR 526 YPD+ L+I +PESR Sbjct: 93 YPDIFMREEVALKINLPESR 112 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 133 LLCLI*IYL-FKY*TVHELLYLQLMYFII 50 LLC+ Y F TVH L L + YF++ Sbjct: 110 LLCVYYFYYAFIIFTVHLLFLLCIYYFVV 138 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 455 SKGVYPDLLATSGDYLRIGVPESR 526 +K YPD+ ++I +PESR Sbjct: 147 AKTRYPDIFMREEVAVKINLPESR 170 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/42 (19%), Positives = 19/42 (45%) Frame = -3 Query: 695 SWTCPRPVQSPSPRWCSRVNTTGANEVRIHSFQSKDVRGAQK 570 +W P P+P + + N + S ++++RG ++ Sbjct: 65 AWQANSPPSPPAPSELPALKSRKLNNNNVVSSTNQEIRGPKR 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,838 Number of Sequences: 336 Number of extensions: 4250 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -