BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021932 (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 174 5e-44 SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) 31 0.73 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.7 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.2 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 2.9 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 2.9 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 2.9 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 2.9 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 5.1 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 5.1 SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) 27 9.0 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 27 9.0 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) 27 9.0 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 174 bits (423), Expect = 5e-44 Identities = 85/104 (81%), Positives = 93/104 (89%), Gaps = 2/104 (1%) Frame = +3 Query: 213 QTREHLLVF-FTNQRFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 389 +T EH+ +F + FEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 390 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGS-HT 518 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIG HT Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Score = 68.1 bits (159), Expect = 5e-12 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +2 Query: 509 KPHTVPCKVTGKCGSVTVRLIPAPRFTGIVSAP 607 KPHTVPCKVTGKCGS VRLIPAPR TGIVSAP Sbjct: 124 KPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAP 156 Score = 51.6 bits (118), Expect = 5e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 163 WVPVTKLGRLVRKGKIDKLESIYLFSLPIKD 255 WVPVTKLGRLV+ KI LE IYLFSLPIK+ Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKE 38 >SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) Length = 389 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/72 (23%), Positives = 28/72 (38%) Frame = +1 Query: 361 HLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEEVTGVTRSEATHRPLQGHR 540 H + T + W+ R + +E ++L LFY S T P H Sbjct: 199 HTISTWTIRGVSRWISYLTRCFTVLYEVFHNILYGLFYSITRGEPAYHSYWTMSPYSAHA 258 Query: 541 QVWFCNSPADSC 576 Q + CN+ ++C Sbjct: 259 QSYICNTSCEAC 270 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = -2 Query: 464 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NFIIQG 285 ++ + NS N D TNMT + + G CL + TC+ L DL N + + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 284 RAEEEI 267 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = -2 Query: 464 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NFIIQG 285 ++ + NS N D TNMT + + G CL + TC+ L DL N + + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 284 RAEEEI 267 R ++E+ Sbjct: 577 RNQDEL 582 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -2 Query: 437 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 306 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 5.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 341 TAHTFQGICCHWRQQRSYW 397 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 339 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 428 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) Length = 956 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 526 LQGHRQVWFCNS-PADSCPS 582 LQ HR WFC S P +CP+ Sbjct: 87 LQSHRHPWFCVSCPTVTCPT 106 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 318 VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRRGY 491 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 1460 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 1515 Query: 492 W 494 W Sbjct: 1516 W 1516 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 299 SSKDHACTETNTCRTAHT-FQGICCHWR-QQRSYWFGCEVQQGSRHCHSRRYYP-C*VVC 469 S+ ++C TN + H + G C S F C G+R CHS Y C V C Sbjct: 683 STGHYSCNLTNGQKVCHRDWYGPFCDVNCNSNSSHFTCNKTTGARVCHSNWYGTYCDVYC 742 Query: 470 FTSS 481 ++S Sbjct: 743 NSNS 746 >SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) Length = 387 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 318 VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRRGY 491 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 274 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 329 Query: 492 W 494 W Sbjct: 330 W 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,090,404 Number of Sequences: 59808 Number of extensions: 420626 Number of successful extensions: 1143 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -