BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021928 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0228 - 16008333-16008752 29 2.7 10_03_0007 - 6956215-6956223,6957082-6957300,6957874-6957978,695... 29 4.8 >10_08_0228 - 16008333-16008752 Length = 139 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = -2 Query: 603 HPPL-RLPINTAWSNFIILILNYYC--LTIIA*VEKNAMQ*LYCGSPRVPHVFFICHGWI 433 H P+ R P+ T + ++ + LTII V NA L +P +P+ F +CHG++ Sbjct: 57 HTPVPRRPMTTCTNAVYAIVTSAIVDSLTIIRFVWGNAEFGLGKAAPAIPYAFRLCHGYL 116 >10_03_0007 - 6956215-6956223,6957082-6957300,6957874-6957978, 6958062-6958175,6958342-6958467,6958583-6958697, 6958791-6958867,6958956-6959179,6959848-6959953, 6960065-6960163,6960282-6960467,6960611-6960613 Length = 460 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 591 RLPINTAWSNFIILILNYYCLTIIA*VEKNAMQ*LYCGSP 472 R P+ T+W+ + I+ Y L + + E+NA L SP Sbjct: 296 RKPLKTSWNEAVFGIIKYLLLQVASLSEENAFALLKADSP 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,779,913 Number of Sequences: 37544 Number of extensions: 312232 Number of successful extensions: 601 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -