BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021924 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0116 + 14805972-14806511,14807095-14807232,14809906-14810352 28 7.1 08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086,406... 28 7.1 >09_04_0116 + 14805972-14806511,14807095-14807232,14809906-14810352 Length = 374 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 260 YFHGKGITSCNKNKNGQ 310 Y HGKGI CN +K Q Sbjct: 86 YLHGKGIFQCNSDKGSQ 102 >08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086, 4066416-4066933,4067435-4067694,4068089-4068594, 4068667-4071319 Length = 2107 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 565 TIRHRYSYKYTC*IFPEQKI-LIAAKEAITSKKPFCSQLHH 684 +++HR+ Y YT +FP+Q + +A S F SQL++ Sbjct: 7 SLQHRHRYTYTSLVFPKQYLEELARVPTEVSSSSFFSQLNN 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,130,372 Number of Sequences: 37544 Number of extensions: 311408 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -