BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021924 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.59 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 24 1.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 5.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 5.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 5.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 5.5 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 5.5 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 9.5 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 9.5 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 25.4 bits (53), Expect = 0.59 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 122 ITVSSFFVQFFNVYC 78 ++ SSFF QFF+ YC Sbjct: 417 LSCSSFFQQFFHCYC 431 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/24 (37%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = -2 Query: 758 LKNHHEIHCDRIAIN--TWLRVNR 693 LK+H++I+C++ N T+LR+ + Sbjct: 155 LKSHNDIYCEKYEKNGETYLRIKK 178 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 442 NRYKYLNNNKSHINMC 395 N YKY NN ++ N C Sbjct: 94 NNYKYNYNNNNYNNNC 109 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 442 NRYKYLNNNKSHINMC 395 N YKY NN ++ N C Sbjct: 94 NNYKYNYNNNNYNNNC 109 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 442 NRYKYLNNNKSHINMC 395 N YKY NN ++ N C Sbjct: 94 NNYKYNYNNNNYNNNC 109 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 442 NRYKYLNNNKSHINMC 395 N YKY NN ++ N C Sbjct: 94 NNYKYNYNNNNYNNNC 109 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 5.5 Identities = 5/9 (55%), Positives = 9/9 (100%) Frame = -2 Query: 227 FIRMICSCC 201 F+R++C+CC Sbjct: 401 FVRILCACC 409 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -3 Query: 490 LLQSNCIFNHDSCTARNRYKYLNNNKSHINMCII 389 +L++ +F D C L + S +N+C+I Sbjct: 107 VLENRWLFTTDWCDVWRSLDVLFSTASILNLCVI 140 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 716 NTWLRVNRRH 687 NTWLRVN + Sbjct: 435 NTWLRVNENY 444 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 716 NTWLRVNRRH 687 NTWLRVN + Sbjct: 435 NTWLRVNENY 444 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,325 Number of Sequences: 438 Number of extensions: 4566 Number of successful extensions: 15 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -