BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021924 (768 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14030.1 68416.m01771 hypothetical protein 31 1.1 At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 29 4.5 >At3g14030.1 68416.m01771 hypothetical protein Length = 200 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = -1 Query: 687 LVVKLRAEWFFGSDSFFSRDQYFLFGENLASIFVAIPVTYCAKFVLCIIFTSK 529 ++ L + F+G+ F+++++ + GE + V + TY F+LC FT++ Sbjct: 1 MITSLSKQSFWGNTYFYAQEKATVEGEGMEE--VDVDTTYLPVFLLCFDFTAE 51 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 413 KPYKYVYNC--CEIQID*T*TCLLNIPP 336 KP KY Y+C C+I++D TC +N PP Sbjct: 89 KPAKYFYSCSTCKIKVD--LTCGMNPPP 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,781,334 Number of Sequences: 28952 Number of extensions: 286389 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -