BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021923 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 75 2e-15 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.1 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 74.9 bits (176), Expect = 2e-15 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 646 NAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAA 762 +AVITVPAYFNDSQRQATKDAG I+GLNV+R+INEPTAA Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAA 39 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 26.2 bits (55), Expect = 1.1 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 451 DRTSIRRSRSAKGHEEFVIQVVRASNGDAW 540 D TSI R+ + + + V+ + R++ G+AW Sbjct: 1338 DETSIHRNNNFQTFPQAVLVLFRSATGEAW 1367 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 857,524 Number of Sequences: 2352 Number of extensions: 20498 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -