BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021921 (711 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p pro... 33 0.38 AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA ... 33 0.38 DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosom... 32 0.67 BT003457-1|AAO39460.1| 985|Drosophila melanogaster RH34107p pro... 31 2.0 AE014297-1126|AAF54512.1| 985|Drosophila melanogaster CG3999-PA... 31 2.0 >BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p protein. Length = 269 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 635 ALKAQRKVVKGEHGKRVRKFRNSVH 709 A K Q+K++KG G R RK R +VH Sbjct: 134 AKKVQKKIIKGAFGTRARKIRTNVH 158 >AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA protein. Length = 277 Score = 33.1 bits (72), Expect = 0.38 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 635 ALKAQRKVVKGEHGKRVRKFRNSVH 709 A K Q+K++KG G R RK R +VH Sbjct: 142 AKKVQKKIIKGAFGTRARKIRTNVH 166 >DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosomal protein naturalvariant protein. Length = 277 Score = 32.3 bits (70), Expect = 0.67 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 635 ALKAQRKVVKGEHGKRVRKFRNSVH 709 A K Q+K++KG G R RK R +VH Sbjct: 142 AKKVQKKIIKGAFGTRARKIRANVH 166 >BT003457-1|AAO39460.1| 985|Drosophila melanogaster RH34107p protein. Length = 985 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 673 MFTFYNLPLSLKCFSNRFHYFFLSLNPSLFG 581 M+ Y+ P LK +NR H+F L+L + G Sbjct: 368 MYAIYHGPEGLKAMANRIHHFTLTLQTGVLG 398 >AE014297-1126|AAF54512.1| 985|Drosophila melanogaster CG3999-PA protein. Length = 985 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 673 MFTFYNLPLSLKCFSNRFHYFFLSLNPSLFG 581 M+ Y+ P LK +NR H+F L+L + G Sbjct: 368 MYAIYHGPEGLKAMANRIHHFTLTLQTGVLG 398 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,364,192 Number of Sequences: 53049 Number of extensions: 197343 Number of successful extensions: 731 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3149551053 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -