BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021910 (649 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26920.1 68416.m03368 F-box family protein contains F-box dom... 28 6.1 At5g49830.1 68418.m06171 expressed protein 27 8.1 >At3g26920.1 68416.m03368 F-box family protein contains F-box domain Pfam:PF00646 Length = 565 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 477 IHCVSFKGSVLFPNGFQNSKTL 542 +H S KGS +FP G N +TL Sbjct: 379 LHVESVKGSFIFPTGLYNCETL 400 >At5g49830.1 68418.m06171 expressed protein Length = 752 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 498 GSVLFPNGFQNSKTLSKEKHNLLFVNYFRRVWYLLIEKLGS 620 GS FQN T S + NL+ ++F V LL +LGS Sbjct: 396 GSRHASTAFQNKLTSSAHRFNLMVQDFFEDVGPLLSMQLGS 436 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,977,983 Number of Sequences: 28952 Number of extensions: 252563 Number of successful extensions: 551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -