BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021908 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.46 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.46 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 27 0.46 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 26 0.80 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 3.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 3.2 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 3.2 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 3.2 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 4.3 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 23 7.5 AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription fact... 23 7.5 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.46 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 199 VDDIGDVTVTNDGATI*KIWK 261 +DD + T+TND AT+ ++WK Sbjct: 34 MDDALNTTLTNDKATLIQVWK 54 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.46 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 199 VDDIGDVTVTNDGATI*KIWK 261 +DD + T+TND AT+ ++WK Sbjct: 34 MDDALNTTLTNDKATLIQVWK 54 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 27.1 bits (57), Expect = 0.46 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 199 VDDIGDVTVTNDGATI*KIWK 261 +DD + T+TND AT+ ++WK Sbjct: 12 MDDALNTTLTNDKATLIQVWK 32 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 26.2 bits (55), Expect = 0.80 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = -2 Query: 258 PDFLYCGTIVSDCNIPNIVNQHLIQT--NWP--KGALYYVCYSRCCHYIL 121 P F+ I D N+P++ +++ +WP G +YY ++ C Y+L Sbjct: 175 PMFIIRQLIHYDVNLPSLGIEYVSYCIEDWPIAYGRVYYSAFTLCVQYVL 224 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 75 FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 188 F C+ ++ +R +E Y+ SK PW W+G Sbjct: 560 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 597 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 75 FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 188 F C+ ++ +R +E Y+ SK PW W+G Sbjct: 560 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 597 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 75 FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 188 F C+ ++ +R +E Y+ SK PW W+G Sbjct: 446 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 483 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 126 ILCSHWVSAGSCPCYRQRCSYSRHFLLYF*HKIHFKIAVT 7 ++C + CP R R +Y+R L + HF +T Sbjct: 125 VVCGDFAGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLT 164 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 488 TWQAVSDNTAKTTMSSKL 541 TW A+ + KTTMS+K+ Sbjct: 80 TWDALQKHHQKTTMSTKV 97 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 511 VIRDGLPSDSTVTVRLS*MYLTASLQARRYPEIMLVG 401 ++R LP+ S V V ++ AS A P I +VG Sbjct: 1 MLRKVLPTSSAVKVARKCVFRNASTAAPIRPRICIVG 37 >AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription factor Deformed protein. Length = 59 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 81 RQRCSYSRHFLLYF*HKIHFKIAVT 7 RQR +Y+RH +L + H+ +T Sbjct: 3 RQRTAYTRHQILELEKEFHYNXYLT 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,109 Number of Sequences: 2352 Number of extensions: 11418 Number of successful extensions: 26 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -