BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021905X (393 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 0.57 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 25 0.75 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 1.7 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 4.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 4.0 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 0.57 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 40 LSRQHHPPFISPRRHNGSPSGNRHQQFPSQAST--LPISGKFQAH 168 L Q HPP + PS +HQQ Q + LP G + H Sbjct: 230 LPHQQHPPGAGVQGAGPIPSQQKHQQHQQQQQSVLLPKHGTARQH 274 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.4 bits (53), Expect = 0.75 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +1 Query: 82 HNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 201 H P QQ+ S P+ K + HD +L P Sbjct: 314 HQHQPQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSP 353 Score = 25.0 bits (52), Expect = 0.99 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +3 Query: 264 HNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQXSQLVP 383 H P QQ+ S P+ K + HD +L P Sbjct: 314 HQHQPQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSP 353 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.2 bits (50), Expect = 1.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 121 PSQASTLPISGKFQAHDINNQQSQLVPG 204 P AST P G FQ+ NN S ++PG Sbjct: 10 PGAASTTPSPGAFQSLARNN--SYVIPG 35 Score = 24.2 bits (50), Expect = 1.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 303 PSQASTLPISGKFQAHDINNQXSQLVPG 386 P AST P G FQ+ NN S ++PG Sbjct: 10 PGAASTTPSPGAFQSLARNN--SYVIPG 35 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 4.0 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 Query: 52 HHPPFISPRRHNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 201 HHP + P H +G H PS + PI + Q + + S P Sbjct: 183 HHPALLHPAYH----TGLHHYYQPSPSHPQPIVPQPQRASLERRDSLFRP 228 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 4.0 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 Query: 52 HHPPFISPRRHNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 201 HHP + P H +G H PS + PI + Q + + S P Sbjct: 183 HHPALLHPAYH----TGLHHYYQPSPSHPQPIVPQPQRASLERRDSLFRP 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 419,866 Number of Sequences: 2352 Number of extensions: 8127 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -