BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021897X (484 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U33267-1|AAB37750.1| 497|Homo sapiens glycine receptor beta sub... 34 0.30 BC032635-1|AAH32635.1| 497|Homo sapiens glycine receptor, beta ... 34 0.30 AF094755-1|AAC71034.1| 497|Homo sapiens glycine receptor beta s... 34 0.30 AF094754-1|AAC71033.1| 497|Homo sapiens glycine receptor beta s... 34 0.30 S81944-1|AAB36480.1| 453|Homo sapiens gamma-aminobutyric acid t... 33 0.40 BC099641-1|AAH99641.1| 453|Homo sapiens gamma-aminobutyric acid... 33 0.40 BC099640-1|AAH99640.1| 453|Homo sapiens gamma-aminobutyric acid... 33 0.40 BC096242-1|AAH96242.1| 453|Homo sapiens gamma-aminobutyric acid... 33 0.40 BC096241-1|AAH96241.1| 453|Homo sapiens gamma-aminobutyric acid... 33 0.40 AF053072-1|AAD19830.1| 74|Homo sapiens GABA subunit A receptor... 33 0.40 U30461-1|AAB52519.1| 554|Homo sapiens GABAA receptor subunit al... 32 1.2 S82769-1|AAB39369.1| 467|Homo sapiens GABAA receptor gamma 3 su... 32 1.2 BC035055-1|AAH35055.1| 554|Homo sapiens gamma-aminobutyric acid... 32 1.2 AF269144-1|AAF99698.1| 467|Homo sapiens GABAA receptor gamma 3 ... 32 1.2 AF228458-1|AAF63215.1| 449|Homo sapiens GABAA receptor gamma 3 ... 32 1.2 BC109211-1|AAI09212.1| 632|Homo sapiens gamma-aminobutyric acid... 31 2.8 BC109210-1|AAI09211.1| 632|Homo sapiens gamma-aminobutyric acid... 31 2.8 AF189259-1|AAF70380.1| 632|Homo sapiens GABA-A receptor theta s... 31 2.8 AF144648-1|AAD51172.1| 627|Homo sapiens GABA-A receptor theta p... 31 2.8 >U33267-1|AAB37750.1| 497|Homo sapiens glycine receptor beta subunit protein. Length = 497 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 373 SAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTSF 474 S IL+ +SYD R+RPN+ G P +V++ + SF Sbjct: 57 SNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSF 91 >BC032635-1|AAH32635.1| 497|Homo sapiens glycine receptor, beta protein. Length = 497 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 373 SAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTSF 474 S IL+ +SYD R+RPN+ G P +V++ + SF Sbjct: 57 SNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSF 91 >AF094755-1|AAC71034.1| 497|Homo sapiens glycine receptor beta subunit precursor protein. Length = 497 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 373 SAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTSF 474 S IL+ +SYD R+RPN+ G P +V++ + SF Sbjct: 57 SNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSF 91 >AF094754-1|AAC71033.1| 497|Homo sapiens glycine receptor beta subunit precursor protein. Length = 497 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 373 SAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTSF 474 S IL+ +SYD R+RPN+ G P +V++ + SF Sbjct: 57 SNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSF 91 >S81944-1|AAB36480.1| 453|Homo sapiens gamma-aminobutyric acid type A receptor alpha 6 subunit protein. Length = 453 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >BC099641-1|AAH99641.1| 453|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 6 protein. Length = 453 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >BC099640-1|AAH99640.1| 453|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 6 protein. Length = 453 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >BC096242-1|AAH96242.1| 453|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 6 protein. Length = 453 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >BC096241-1|AAH96241.1| 453|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 6 protein. Length = 453 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >AF053072-1|AAD19830.1| 74|Homo sapiens GABA subunit A receptor alpha 6 precursor protein. Length = 74 Score = 33.5 bits (73), Expect = 0.40 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 355 FGDVNISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 F N+S ILD+ YD R+RP +GG V ++ TSF Sbjct: 27 FYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSF 67 >U30461-1|AAB52519.1| 554|Homo sapiens GABAA receptor subunit alpha4 protein. Length = 554 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 367 NISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 N + ILDS YD R+RP +GG V ++ TSF Sbjct: 47 NFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSF 83 >S82769-1|AAB39369.1| 467|Homo sapiens GABAA receptor gamma 3 subunit protein. Length = 467 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 361 DVNISAILDSFSISYDKRVRPNYGGKPNVI 450 D +++ IL+ YDK++RP+ G KP VI Sbjct: 44 DTDVTLILNKLLREYDKKLRPDIGIKPTVI 73 >BC035055-1|AAH35055.1| 554|Homo sapiens gamma-aminobutyric acid (GABA) A receptor, alpha 4 protein. Length = 554 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 367 NISAILDSFSISYDKRVRPNYGGK-PNVIIEVLKTSF 474 N + ILDS YD R+RP +GG V ++ TSF Sbjct: 47 NFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSF 83 >AF269144-1|AAF99698.1| 467|Homo sapiens GABAA receptor gamma 3 subunit protein. Length = 467 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 361 DVNISAILDSFSISYDKRVRPNYGGKPNVI 450 D +++ IL+ YDK++RP+ G KP VI Sbjct: 44 DTDVTLILNKLLREYDKKLRPDIGIKPTVI 73 >AF228458-1|AAF63215.1| 449|Homo sapiens GABAA receptor gamma 3 subunit protein. Length = 449 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 361 DVNISAILDSFSISYDKRVRPNYGGKPNVI 450 D +++ IL+ YDK++RP+ G KP VI Sbjct: 26 DTDVTLILNKLLREYDKKLRPDIGIKPTVI 55 >BC109211-1|AAI09212.1| 632|Homo sapiens gamma-aminobutyric acid (GABA) receptor, theta protein. Length = 632 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 370 ISAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTS 471 + ILD YD R+RPN+GG P V I + TS Sbjct: 59 VQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTS 93 >BC109210-1|AAI09211.1| 632|Homo sapiens gamma-aminobutyric acid (GABA) receptor, theta protein. Length = 632 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 370 ISAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTS 471 + ILD YD R+RPN+GG P V I + TS Sbjct: 59 VQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTS 93 >AF189259-1|AAF70380.1| 632|Homo sapiens GABA-A receptor theta subunit protein. Length = 632 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 370 ISAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTS 471 + ILD YD R+RPN+GG P V I + TS Sbjct: 59 VQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTS 93 >AF144648-1|AAD51172.1| 627|Homo sapiens GABA-A receptor theta protein. Length = 627 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 370 ISAILDSFSISYDKRVRPNYGGKP-NVIIEVLKTS 471 + ILD YD R+RPN+GG P V I + TS Sbjct: 54 VQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTS 88 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,863,238 Number of Sequences: 237096 Number of extensions: 874048 Number of successful extensions: 1559 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1559 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4327667848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -