BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021895 (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 0.77 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 25 2.3 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 5.4 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.2 bits (55), Expect = 0.77 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = +3 Query: 396 GPLIIFNKDQGLTR-AFRNIPGVELLNV--NKLKPPEAGS 506 G +I N + TR AF+++P +++LNV NK+ E G+ Sbjct: 515 GLRLISNNIENFTRKAFKDLPSLQILNVARNKISYIEKGA 554 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +3 Query: 216 KDSRASHGCSRQSQEINKTKQAVIFLR 296 K+ + CS ++ ++KT A++F+R Sbjct: 81 KEGKCIPKCSNENMPLSKTSTAILFVR 107 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 5.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -3 Query: 58 RRHPDRTYEYHHHGH 14 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,461 Number of Sequences: 2352 Number of extensions: 11128 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -