BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021894 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 0.67 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 26 1.1 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 26 1.1 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 26 1.1 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 26 1.1 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 26 1.1 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 26 1.1 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 25 1.5 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 1.5 AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 25 2.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 4.4 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 24 4.4 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.4 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 24 4.4 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 5.9 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.9 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 23 7.8 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 23 7.8 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 23 7.8 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect(2) = 0.67 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +1 Query: 304 WWWYS*VRSGCLR*HVSWWTYVRPHEALAALASSRQPPTAE-SGLGGSVAATGVPALVQA 480 WW V+ GC + + A+ A S + T++ S G++ A+GVP + Sbjct: 128 WWIGRLVKEGCEVGFIPSPVKLEHIRMQASAARSSKLYTSKGSSSSGNLGASGVPGAEPS 187 Query: 481 RG 486 RG Sbjct: 188 RG 189 Score = 21.4 bits (43), Expect(2) = 0.67 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 526 PTKSRRSTRPNRLSSS*GASRHG 594 P++ P S S GASRHG Sbjct: 186 PSRGSTPPTPGDDSDSMGASRHG 208 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCESQSPGDQTTTT 100 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCEPQSPGDQTTTT 100 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 503 FPTSPGCSRQSPGDQQDQT 559 FP + C QSPGDQ T Sbjct: 82 FPVNAKCEPQSPGDQTTTT 100 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 260 SWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 361 S+G+G+ +P + G G +SG +FGN +GG Sbjct: 130 SFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -2 Query: 359 HHDTCYRRHPDRTYEY-HHHGHAEFGRQHVRYPMIRTGLVTSLLAHAVGLPR 207 HH + + P + ++ HHH H Q+ + T T +H+ LP+ Sbjct: 641 HHQS---QQPQQQQQHQHHHHHHHHHHQNPNDHFVNTNTDTIKRSHSAQLPQ 689 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 152 GAHTSGPGQ*CSRFYVQELEAALLR 226 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 361 TYVRPHEALAALASSRQPPTAESGLGGS 444 T+ PH A A SS T+ SG GGS Sbjct: 741 THPSPHPATRASPSSPIVATSSSGGGGS 768 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 152 GAHTSGPGQ*CSRFYVQELEAALLR 226 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 5.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 341 RRHPDRTYEYHHHGH 297 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 5.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 110 DGAGCSQAPPVRVQGAHTSGPG 175 DG +PP+ V G+ S PG Sbjct: 153 DGLHSIPSPPITVSGSDMSSPG 174 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 205 TRGSPTA*ARRLVTKPVRIMGYRTCC 282 TRG P R L +K + + TCC Sbjct: 177 TRGKPAIAHRDLKSKNILVKSNLTCC 202 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 147 TRTGGAWLHPAPSRSFLNTPTLKVGLPIDSFRYFSE 40 T + +LH P+R L T++ GL D F++ Sbjct: 175 TSSSELFLHTEPARCLLRCFTIRAGLYSDQHGPFAD 210 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 147 TRTGGAWLHPAPSRSFLNTPTLKVGLPIDSFRYFSE 40 T + +LH P+R L T++ GL D F++ Sbjct: 175 TSSSELFLHTEPARCLLRCFTIRAGLYSDQHGPFAD 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,835 Number of Sequences: 2352 Number of extensions: 13373 Number of successful extensions: 52 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -