BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021894 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 104 4e-23 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 104 4e-23 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.8 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 4.2 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 4.2 At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putati... 28 5.6 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 5.6 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 7.4 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 7.4 At1g76010.1 68414.m08825 expressed protein 27 7.4 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 9.8 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 9.8 At5g05340.1 68418.m00575 peroxidase, putative similar to peroxid... 27 9.8 At2g20570.1 68415.m02402 golden2-like transcription factor (GLK1... 27 9.8 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 27 9.8 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 27 9.8 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 104 bits (250), Expect = 4e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 70 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 71.3 bits (167), Expect = 5e-13 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = +3 Query: 66 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 239 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 240 GHQTS 254 GHQTS Sbjct: 65 GHQTS 69 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPDFP 516 ++AAT VPALV ARGH IE +P+ P Sbjct: 133 AIAATAVPALVMARGHKIENVPEMP 157 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 104 bits (250), Expect = 4e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 69 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 73.3 bits (172), Expect = 1e-13 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +3 Query: 57 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 230 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 231 KEAGHQTS 254 K+AGHQTS Sbjct: 61 KKAGHQTS 68 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPDFP 516 ++AAT VPALV ARGH IE +P+ P Sbjct: 132 AIAATAVPALVMARGHKIENVPEMP 156 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 81 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 206 LEAALLREQGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 376 + AL+R + G P +E + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMGAKPT-AEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 377 TKPW 388 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9QXA5 U6 snRNA-associated Sm-like protein LSm4 [Mus musculus] Length = 129 Score = 27.9 bits (59), Expect = 5.6 Identities = 22/52 (42%), Positives = 26/52 (50%) Frame = +3 Query: 402 VASTSDSGERPWRQRCCYRRPSTRSG*RTHY*KDSRLPLVVADKVQEINKTK 557 V TS G+R WR CY R +T K R+P V DKVQE KT+ Sbjct: 43 VICTSKDGDRFWRMPECYIRGNTI--------KYLRVPDEVIDKVQE-EKTR 85 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEF 288 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.5 bits (58), Expect = 7.4 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 361 QGG Q G GR R +GGG + G G+ G+ CR G Sbjct: 79 QGGGGRYQG---GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 276 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 358 +GG+ Q G GR R R RGGG R G G F N G Sbjct: 305 RGGYDGPQGRGRGRGRG--RGGRGRGGG--RGGDGGFNNRSDG 343 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQH 276 R++ H + +H D + E+HHH H R+H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKH 767 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQH 276 R++ H + +H D + E+HHH H R+H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKH 767 >At5g05340.1 68418.m00575 peroxidase, putative similar to peroxidase [Nicotiana tabacum] gi|5381253|dbj|BAA82306; similar to Peroxidase P7 [Brassica rapa (Turnip)] SWISS-PROT:P00434 Length = 324 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 56 NESIGSPTFSVGVFRKERDGAGCSQAPPVRVQGAHTSGPGQ*CSRF 193 N +I +PT S+ G S V + GAHT G + C+ F Sbjct: 163 NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSR-CTNF 207 >At2g20570.1 68415.m02402 golden2-like transcription factor (GLK1) identical to golden2-like transcription factor GI:13311003 from [Arabidopsis thaliana]; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 420 Score = 27.1 bits (57), Expect = 9.8 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 201 WT*KREHH*PGPDVWAP*T-RTGGAWLHPAPSRSFLNTPTLKVGLP 67 WT KR H G D A RT WL PAP+ F P + V P Sbjct: 221 WTRKR--HIYGVDTGANLNGRTKNGWLAPAPTLGFPPPPPVAVAPP 264 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 236 GWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 376 G P Q + +G + R RGG H+ G+G +G GG P Sbjct: 65 GQPPQQQQQYGGPQEYQG--RGRGGPPHQGGRGGYGGGRGGGPSSGP 109 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 236 GWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 376 G P Q + +G + R RGG H+ G+G +G GG P Sbjct: 65 GQPPQQQQQYGGPQEYQG--RGRGGPPHQGGRGGYGGGRGGGPSSGP 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,459,393 Number of Sequences: 28952 Number of extensions: 285084 Number of successful extensions: 976 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -