BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021889 (678 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe... 33 0.050 SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2... 26 4.4 SPAC16E8.03 |gna1|spgna1|glucosamine-phosphate N-acetyltransfera... 25 7.6 >SPAC1687.05 |pli1||SUMO E3 ligase Pli1|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 32.7 bits (71), Expect = 0.050 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 578 AGRGTHPRGLTRGPTTSNYANYNLRVSFLLHDVIPSPWK 462 AG G G R P+ N N N + S LH ++PSP++ Sbjct: 532 AGEGGLLSGALRAPSQQNNNNSNTQHSINLHTIVPSPYE 570 >SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.2 bits (55), Expect = 4.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 470 PWKSIVKFVEYVFH*KNWYRR 408 PW ++ K V+ +F +NW+ R Sbjct: 119 PWDTVPKAVDRIFRSQNWHAR 139 >SPAC16E8.03 |gna1|spgna1|glucosamine-phosphate N-acetyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 111 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 368 FRINSETAKLVCDKSNLNFYVNCYPIKSGCSL 273 F +NS L C SN+ FY C ++G + Sbjct: 71 FSLNSYKVILDCSDSNVGFYEKCGLSRAGIEM 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,717,372 Number of Sequences: 5004 Number of extensions: 55350 Number of successful extensions: 138 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -