BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021887 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_22533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 467 QLPV*FNFLTNKPYFALTGIRSCEKVGPRLVELR 366 QLPV F N+P + +G R CEKV RL +L+ Sbjct: 12 QLPVQPKFPYNEPTYNFSGQRYCEKV-KRLADLK 44 >SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -1 Query: 501 NPEPHTSTQPRPASSVIQFSD*QTLFRPNRYSLMRKSGS 385 NP P +ST P P SS I T P R + G+ Sbjct: 528 NPTPQSSTSPTPQSSTIHTPQSSTSPTPQRSAAQNNGGA 566 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,241,203 Number of Sequences: 59808 Number of extensions: 398221 Number of successful extensions: 888 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -