BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021886 (561 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 47 1e-05 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 47 1e-05 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 46 1e-05 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 46 1e-05 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 46 2e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 46 2e-05 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 44 7e-05 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 44 7e-05 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 44 9e-05 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 43 1e-04 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 43 2e-04 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 43 2e-04 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 43 2e-04 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 42 2e-04 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 42 3e-04 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 41 7e-04 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 41 7e-04 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 41 7e-04 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 41 7e-04 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 41 7e-04 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 40 0.002 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 40 0.002 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 39 0.002 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 39 0.002 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 39 0.003 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 39 0.003 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 39 0.003 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 39 0.003 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 39 0.003 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 39 0.003 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 38 0.003 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 38 0.003 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 38 0.003 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 38 0.003 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 38 0.003 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 38 0.003 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 38 0.005 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 38 0.005 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 38 0.005 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 38 0.005 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 37 0.008 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 37 0.011 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 37 0.011 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 37 0.011 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 37 0.011 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 37 0.011 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 37 0.011 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 37 0.011 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 37 0.011 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 36 0.014 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 36 0.014 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 36 0.014 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 36 0.014 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 36 0.014 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 36 0.019 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 36 0.019 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 36 0.019 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 36 0.019 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 36 0.019 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 36 0.019 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 36 0.019 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 36 0.019 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 36 0.019 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 36 0.019 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.019 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 36 0.019 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 36 0.024 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.024 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 36 0.024 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 35 0.032 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 35 0.032 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 35 0.032 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 35 0.032 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 35 0.032 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 35 0.032 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.032 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 35 0.032 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 35 0.032 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 35 0.032 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 35 0.032 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 35 0.043 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 35 0.043 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 35 0.043 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 35 0.043 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 34 0.057 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 34 0.057 At2g47310.1 68415.m05906 flowering time control protein-related ... 34 0.075 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.075 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 34 0.075 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 34 0.075 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 34 0.075 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 34 0.075 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.099 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 33 0.099 At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RS... 33 0.099 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 33 0.13 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 33 0.13 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 33 0.13 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 33 0.13 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 33 0.13 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 33 0.13 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 33 0.13 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 33 0.13 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 33 0.17 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 33 0.17 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 33 0.17 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 33 0.17 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 33 0.17 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.17 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 32 0.23 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 32 0.23 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 32 0.23 At1g72880.2 68414.m08430 acid phosphatase survival protein SurE,... 32 0.23 At1g72880.1 68414.m08429 acid phosphatase survival protein SurE,... 32 0.23 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 32 0.30 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 32 0.30 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 32 0.30 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 32 0.30 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 32 0.30 At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) famil... 32 0.30 At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) famil... 32 0.30 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 31 0.40 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 31 0.40 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 31 0.40 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 31 0.53 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 31 0.53 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 31 0.53 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 0.53 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 31 0.53 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 31 0.53 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 31 0.53 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 31 0.53 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 31 0.70 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 31 0.70 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 31 0.70 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 31 0.70 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 31 0.70 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 30 0.92 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 30 0.92 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 30 1.2 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 30 1.2 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 30 1.2 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 29 1.6 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 29 1.6 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 29 1.6 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 29 1.6 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 29 1.6 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 29 2.1 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 2.8 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 29 2.8 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 29 2.8 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 29 2.8 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 29 2.8 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 29 2.8 At3g14770.1 68416.m01867 nodulin MtN3 family protein similar to ... 29 2.8 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 29 2.8 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 28 3.7 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 28 3.7 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 28 3.7 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 28 4.9 At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing ... 28 4.9 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 28 4.9 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 28 4.9 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 27 6.5 At4g01070.1 68417.m00145 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.5 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 27 6.5 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 27 6.5 At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related ... 27 6.5 At5g53890.1 68418.m06703 leucine-rich repeat transmembrane prote... 27 8.6 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 27 8.6 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 27 8.6 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 46.8 bits (106), Expect = 1e-05 Identities = 20/56 (35%), Positives = 34/56 (60%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELNG 500 T+++VG L+ +TR ++ LF ++G V + D+ R+Y FV D +DA L+G Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDG 66 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMEN 226 G ++++G LS +T DL LF +YG V + D+ R+Y FV + Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSD 53 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 46.8 bits (106), Expect = 1e-05 Identities = 20/56 (35%), Positives = 34/56 (60%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELNG 500 T+++VG L+ +TR ++ LF ++G V + D+ R+Y FV D +DA L+G Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDG 66 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFV 214 G ++++G LS +T DL LF +YG V + D+ R+Y FV Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFV 49 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 46.4 bits (105), Expect = 1e-05 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 8/94 (8%) Frame = +3 Query: 258 NGELVHGQAIKIE-AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV- 431 N L++G+ I++ + ++ A +FV NL + ++++F+KFG +V C + Sbjct: 86 NNSLLNGKMIRVMWSVRAPDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVAT 145 Query: 432 ------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 R YGFV + + AI+ LN +V D Sbjct: 146 LEDGKSRGYGFVQFEQEDAAHAAIQTLNSTIVAD 179 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREPF 250 G +F+ NL + T A L+ +F+K+G +V C + R YGFV E E Sbjct: 110 GVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAI 169 Query: 251 RT 256 +T Sbjct: 170 QT 171 Score = 32.3 bits (70), Expect = 0.23 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 10/92 (10%) Frame = +3 Query: 255 LNGELVHGQAI---KIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECD 425 LN +V + I K R P T +++ NL +RE F +FG +V Sbjct: 172 LNSTIVADKEIYVGKFMKKTDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFGKIVSLA 231 Query: 426 IV-------RNYGFVHLDATGDVNDAIKELNG 500 I R Y FV+ D D A + +NG Sbjct: 232 IAKDENRLCRGYAFVNFDNPEDARRAAETVNG 263 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFVHLDATGDVNDAIKE 491 + I+V N+ E+R+ F + GT+ ++ + +GFV + DA+K Sbjct: 304 SNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKT 363 Query: 492 LNGMMVTDSP 521 +G M P Sbjct: 364 FHGQMFHGKP 373 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 46.4 bits (105), Expect = 1e-05 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%) Frame = +3 Query: 252 ELNGELVHGQAIKIE-AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 428 +LN ++G+ I+I +++ A + +FV NL + E F GT+V C + Sbjct: 106 KLNYSYLNGKMIRITYSSRDSSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKV 165 Query: 429 V-------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 R YGFV D +AI++LNG ++ D Sbjct: 166 ATDHMGQSRGYGFVQFDTEDSAKNAIEKLNGKVLND 201 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAIKELN 497 ++V NL D ++RELF +FGT+ C ++R+ GFV A + + + E+N Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNEMN 389 Query: 498 GMMVTDSP 521 G MV P Sbjct: 390 GKMVGGKP 397 Score = 38.3 bits (85), Expect = 0.003 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 13/110 (11%) Frame = +3 Query: 225 TNKSAANHSE-LNGELVHGQAIKI-----EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVR 386 T SA N E LNG++++ + I + + + A T ++V NL++ T E++ Sbjct: 183 TEDSAKNAIEKLNGKVLNDKQIFVGPFLRKEERESAADKMKFTNVYVKNLSEATTDDELK 242 Query: 387 ELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAIKELNGMMVTD 515 F ++G++ ++R+ +GFV+ + D A++ LNG D Sbjct: 243 TTFGQYGSISSAVVMRDGDGKSRCFGFVNFENPEDAARAVEALNGKKFDD 292 Score = 33.9 bits (74), Expect = 0.075 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 7/50 (14%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQ 232 +++ NLS+ TT+ +L+ F +YG++ ++R+ +GFV+ EN + Sbjct: 227 VYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDGKSRCFGFVNFENPE 276 Score = 30.3 bits (65), Expect = 0.92 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 7/69 (10%) Frame = +2 Query: 44 LLFFVHSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RN 202 ++ +S+ S +G +F+ NL L F GT+V C + R Sbjct: 116 MIRITYSSRDSSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRG 175 Query: 203 YGFVHMENE 229 YGFV + E Sbjct: 176 YGFVQFDTE 184 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/53 (37%), Positives = 31/53 (58%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELN 497 +FVGN +TR ++ LF K+G V D+ Y FV+ + D DAI++L+ Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLD 56 Score = 46.0 bits (104), Expect = 2e-05 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREPFR 253 +F+GN +T ++DL LF+KYG V D+ Y FV+ E+E+ + R Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIR 53 Score = 33.1 bits (72), Expect = 0.13 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 95 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 T +F+ N +T E D+ FE YG V I RN+ FV E ++ Sbjct: 92 TKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQE 138 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 45.6 bits (103), Expect = 2e-05 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 7/128 (5%) Frame = +3 Query: 159 SKNTVRS*NAISSEITVSCTWKTNKSAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTK 338 S + R+ +A++ + W K A SE EL K E + A + + Sbjct: 274 SDDAARAVDALNGKTFDDKEWFVGK-AQKKSERETELKQ----KFEQSLKEAADKSQGSN 328 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAIKELN 497 ++V NL + ++RE F FGT+ C ++R+ GFV + AI E+N Sbjct: 329 LYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITEMN 388 Query: 498 GMMVTDSP 521 G M+ P Sbjct: 389 GKMIVTKP 396 Score = 44.8 bits (101), Expect = 4e-05 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 8/97 (8%) Frame = +3 Query: 249 SELNGELVHGQAIKIE-AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECD 425 +ELN ++G+AI++ + + + IF+ NL + E F FG ++ C Sbjct: 104 NELNFMALNGRAIRVMYSVRDPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPILSCK 163 Query: 426 IV-------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 + + YGFV D AI +LNGM++ D Sbjct: 164 VAVDPSGQSKGYGFVQYDTDEAAQGAIDKLNGMLLND 200 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 12/100 (12%) Frame = +3 Query: 252 ELNGELVHGQAIKIE--AAKSRKAPS---TPTTKIFVGNLTDKTRAPEVRELFQKFGTVV 416 +LNG L++ + + + K ++ PS T ++V NL++ E+ ++F +FG Sbjct: 192 KLNGMLLNDKQVYVGPFVHKLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTT 251 Query: 417 ECDIVRN-------YGFVHLDATGDVNDAIKELNGMMVTD 515 C I+R+ +GFV+ + + D A+ LNG D Sbjct: 252 SCVIMRDGEGKSKGFGFVNFENSDDAARAVDALNGKTFDD 291 Score = 32.7 bits (71), Expect = 0.17 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Frame = +3 Query: 297 AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVH 452 AA + A TT ++VG+L ++ E F + G VV + R+ YG+V+ Sbjct: 33 AAAAAGAAQQGTTSLYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVN 92 Query: 453 LDATGDVNDAIKELNGM 503 D + A+ ELN M Sbjct: 93 YATPQDASRALNELNFM 109 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 44.0 bits (99), Expect = 7e-05 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 10/96 (10%) Frame = +3 Query: 243 NHSELNGELVHGQAIKIEAAKSRKAPST--PTTKIFVGNLTDKTRAPEVRELFQKFGTVV 416 N +LNG L+ ++ +AP P +++VGNL + +LF + G VV Sbjct: 212 NRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVV 271 Query: 417 ECDIV--------RNYGFVHLDATGDVNDAIKELNG 500 E +V R +GFV + ++N+AI L+G Sbjct: 272 EARVVYDRETGRSRGFGFVTMSDVDELNEAISALDG 307 Score = 32.3 bits (70), Expect = 0.23 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 8/62 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVV--------ECDIVRNYGFVHLDATGDVNDAIKE 491 K+FVGNL + + LF++ GTV E D R +GFV + + + A+++ Sbjct: 151 KLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEK 210 Query: 492 LN 497 N Sbjct: 211 FN 212 Score = 30.7 bits (66), Expect = 0.70 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 8/51 (15%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMEN 226 F++++GNL L LF ++G VVE +V R +GFV M + Sbjct: 244 FRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSD 294 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+F+GNL+ L LFE+ GTV +++ N Sbjct: 151 KLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYN 184 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 44.0 bits (99), Expect = 7e-05 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 14/112 (12%) Frame = +3 Query: 222 KTNKSAANHSELNGELVHGQAIKI-------EAAKSRKAPSTPTTKIFVGNLTDKTRAPE 380 K + A +LNG L++ + + + E A+ P+ T ++V NL + E Sbjct: 185 KEESAQAAIDKLNGMLMNDKQVFVGHFIRRQERARDENTPTPRFTNVYVKNLPKEIGEDE 244 Query: 381 VRELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAIKELNGMMVTD 515 +R+ F KFG + ++R+ +GFV+ + T A++++NG+ + D Sbjct: 245 LRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMNGISLGD 296 Score = 40.3 bits (90), Expect = 9e-04 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Frame = +3 Query: 306 SRKAPSTPTT---KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFVHL 455 S + PST + IF+ NL + E F FGT++ C + + YGFV Sbjct: 124 SNRDPSTRLSGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQF 183 Query: 456 DATGDVNDAIKELNGMMVTD 515 + AI +LNGM++ D Sbjct: 184 EKEESAQAAIDKLNGMLMND 203 Score = 35.1 bits (77), Expect = 0.032 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 7/85 (8%) Frame = +3 Query: 288 KIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGF 446 K E + + + +++ NL D +++E+F ++G V ++ R +GF Sbjct: 317 KFEQERINRFEKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGF 376 Query: 447 VHLDATGDVNDAIKELNGMMVTDSP 521 V + A+ E+NG M+ P Sbjct: 377 VAYSNPEEALRALSEMNGKMIGRKP 401 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 7/71 (9%) Frame = +2 Query: 41 ILLFFVHSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------R 199 I + + +P +++ G G IFI NL L F +GT++ C + + Sbjct: 119 IRIMLSNRDPSTRLSGKGN--IFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSK 176 Query: 200 NYGFVHMENEQ 232 YGFV E E+ Sbjct: 177 GYGFVQFEKEE 187 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 43.6 bits (98), Expect = 9e-05 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TKIFVGNLT +T A ++R F++FG VV+ ++V Sbjct: 9 TRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVV 44 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = +2 Query: 89 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 T KIF+GNL+ +TT DLR FE++G VV+ ++V Sbjct: 9 TRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVV 44 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = +3 Query: 345 VGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKELNG 500 V NL++ TR P++ ELF+ FG V C + R +GFV + D AI +LNG Sbjct: 178 VTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNG 237 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREPFR 253 +F GN E+DL LF KYG V D+ + FV+ME+E+ + R Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIR 53 Score = 40.3 bits (90), Expect = 9e-04 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELN 497 +F GN R ++ LF+K+G V D+ + FV+++ D DAI+ L+ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALD 56 Score = 31.1 bits (67), Expect = 0.53 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 104 IFIGNLSDKTTEA-DLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 +F+ N + T DL FE YG +V I RN+ F+ E ++ Sbjct: 98 LFVINFDAQNTRTRDLERHFEPYGKIVNVRIRRNFAFIQYEAQE 141 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREPFR 253 +F GN E+DL LF KYG V D+ + FV+ME+E+ + R Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIR 53 Score = 40.3 bits (90), Expect = 9e-04 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELN 497 +F GN R ++ LF+K+G V D+ + FV+++ D DAI+ L+ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALD 56 Score = 31.1 bits (67), Expect = 0.53 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 104 IFIGNLSDKTTEA-DLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 +F+ N + T DL FE YG +V I RN+ F+ E ++ Sbjct: 98 LFVINFDAQNTRTRDLERHFEPYGKIVNVRIRRNFAFIQYEAQE 141 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIK 488 ++VGN TR ++ LF KFG V D+ Y FV+ + D DAI+ Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIR 53 Score = 41.1 bits (92), Expect = 5e-04 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREPFR 253 +++GN T +DL LF K+G V D+ Y FV+ E+E+ + R Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIR 53 Score = 31.5 bits (68), Expect = 0.40 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 327 PTTKIFVGNLTD-KTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELNGM 503 PT +FV N +TR ++ F+ +G V+ + RN+ FV D A+ + Sbjct: 93 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 152 Query: 504 MVTD 515 + D Sbjct: 153 KLLD 156 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 95 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 T +F+ N +T E D+ FE YG V+ + RN+ FV ++ Sbjct: 94 TKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQE 140 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 42.3 bits (95), Expect = 2e-04 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREPFR 253 +F GN E DL LF KYG V D+ + FV+ME+E+ + R Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIR 53 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELN 497 +F GN R ++ LF+K+G V D+ + FV+++ D DAI+ L+ Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALD 56 Score = 33.5 bits (73), Expect = 0.099 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 104 IFIGNL-SDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 +F+ N +D T DL FE YG +V I RN+ F+ E ++ Sbjct: 99 LFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQE 142 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFVHLDATGDVNDAIKELN 497 ++V NL D ++ ELF +FGT+ C ++ + GFV + + + A+ ++N Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAMLKMN 284 Query: 498 GMMVTDSP 521 G MV + P Sbjct: 285 GKMVGNKP 292 Score = 37.9 bits (84), Expect = 0.005 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 9/95 (9%) Frame = +3 Query: 258 NGELVHGQAIKIEAAKSRKA--PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 NG L+ Q I + SR S T ++V NL + +++ LF +FG + ++ Sbjct: 92 NGTLIRNQHIHVCPFVSRGQWDKSRVFTNVYVKNLVETATDADLKRLFGEFGEITSAVVM 151 Query: 432 -------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 R +GFV+ + AI+++NG++V + Sbjct: 152 KDGEGKSRRFGFVNFEKAEAAVTAIEKMNGVVVDE 186 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAI 485 S + ++VGNL R EV +LF K+G VV+ D+ Y FV D D DAI Sbjct: 3 SRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAI 62 Query: 486 KELNG 500 +G Sbjct: 63 HGRDG 67 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 +++GNL E ++ LF KYG VV+ D+ Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 41.9 bits (94), Expect = 3e-04 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAI 485 S + ++VGNL R EV +LF K+G VV+ D+ Y FV D D DAI Sbjct: 3 SRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAI 62 Query: 486 KELNG 500 +G Sbjct: 63 HGRDG 67 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 +++GNL E ++ LF KYG VV+ D+ Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAI 485 S + ++VGNL R EV +LF K+G VV+ D+ Y FV D D DAI Sbjct: 3 SRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAI 62 Query: 486 KELNG 500 +G Sbjct: 63 HGRDG 67 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 +++GNL E ++ LF KYG VV+ D+ Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 40.7 bits (91), Expect = 7e-04 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAI 485 S + I+VGNL R EV +LF K+G VV+ D+ Y FV + D +DAI Sbjct: 3 SRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAI 62 Query: 486 KELNG 500 +G Sbjct: 63 YGRDG 67 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 I++GNL E ++ LF KYG VV+ D+ Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 40.7 bits (91), Expect = 7e-04 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAI 485 S + I+VGNL R EV +LF K+G VV+ D+ Y FV + D +DAI Sbjct: 3 SRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAI 62 Query: 486 KELNG 500 +G Sbjct: 63 YGRDG 67 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 I++GNL E ++ LF KYG VV+ D+ Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 40.7 bits (91), Expect = 7e-04 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 8/96 (8%) Frame = +3 Query: 255 LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 +NG+ V + + A ++ T KIFVG + E+++ F K+G VVE ++R Sbjct: 83 INGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIR 142 Query: 435 N--------YGFVHLDATGDVNDAIKELNGMMVTDS 518 + +GFV D+ V++ + + N + + D+ Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADT 178 Score = 40.7 bits (91), Expect = 7e-04 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 8/55 (14%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQV 235 T KIF+G + TE +L+ F KYG VVE ++R+ +GFV ++E+V Sbjct: 108 TKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEV 162 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G KIFIG L TT F KYG + + I+R+ Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRD 53 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 40.7 bits (91), Expect = 7e-04 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 8/96 (8%) Frame = +3 Query: 255 LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 +NG+ V + + A ++ T KIFVG + E+++ F K+G VVE ++R Sbjct: 83 INGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIR 142 Query: 435 N--------YGFVHLDATGDVNDAIKELNGMMVTDS 518 + +GFV D+ V++ + + N + + D+ Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADT 178 Score = 40.7 bits (91), Expect = 7e-04 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 8/55 (14%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQV 235 T KIF+G + TE +L+ F KYG VVE ++R+ +GFV ++E+V Sbjct: 108 TKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEV 162 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G KIFIG L TT F KYG + + I+R+ Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRD 53 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 40.7 bits (91), Expect = 7e-04 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 10/80 (12%) Frame = +3 Query: 306 SRKAPSTPTT---KIFVGNLTDKTRAPEVRELFQKFGTVVEC----DIV---RNYGFVHL 455 S + PST + +F+ NL + E F FGT++ C D+V + YGFV Sbjct: 120 SNRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQF 179 Query: 456 DATGDVNDAIKELNGMMVTD 515 + AI +LNGM++ D Sbjct: 180 EKEETAQAAIDKLNGMLLND 199 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 7/85 (8%) Frame = +3 Query: 288 KIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGF 446 K E + + + +++ NL D +++E+F ++G V C ++ N +GF Sbjct: 313 KFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGF 372 Query: 447 VHLDATGDVNDAIKELNGMMVTDSP 521 V + A+KE+NG M+ P Sbjct: 373 VAYSNPEEALLAMKEMNGKMIGRKP 397 Score = 33.9 bits (74), Expect = 0.075 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Frame = +2 Query: 41 ILLFFVHSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVEC----DIV---R 199 I + + +P +++ G G +FI NL L F +GT++ C D+V + Sbjct: 115 IRIMLSNRDPSTRLSGKGN--VFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSK 172 Query: 200 NYGFVHMENEQVGR 241 YGFV E E+ + Sbjct: 173 GYGFVQFEKEETAQ 186 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 7/89 (7%) Frame = +3 Query: 282 AIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------Y 440 A+ AA + + P + ++VG+L + +LF + V + R+ Y Sbjct: 28 AVAAAAAAAEALQTHPNSSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRDLTHRSLGY 87 Query: 441 GFVHLDATGDVNDAIKELNGMMVTDSP*R 527 +V+ D + A++ LN + D P R Sbjct: 88 AYVNFANPEDASRAMESLNYAPIRDRPIR 116 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 ++K+FVG L+ T +++ F FG V E ++ R +GFV N+AI Sbjct: 34 SSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Query: 486 KELNG 500 KE++G Sbjct: 94 KEMDG 98 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 ++K+FVG L+ T +++ F FG V E ++ R +GFV N+AI Sbjct: 34 SSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Query: 486 KELNG 500 KE++G Sbjct: 94 KEMDG 98 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 39.1 bits (87), Expect = 0.002 Identities = 29/81 (35%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +2 Query: 14 GVHIFNLCYILLFFVHSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 GV LCY + S SK G +F+G LS TTE LR + KYG + + Sbjct: 37 GVRRALLCYNAGLYDPSGD-SKAVGDPYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRL 95 Query: 194 VRN--------YGFVHMENEQ 232 VR+ YGFV E E+ Sbjct: 96 VRHIVTGASRGYGFVEYETEK 116 Score = 31.5 bits (68), Expect = 0.40 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 8/74 (10%) Frame = +3 Query: 312 KAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATG 467 KA P +FVG L+ T +RE+ K+G + +VR+ YGFV + Sbjct: 57 KAVGDPYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEK 116 Query: 468 DVNDAIKELNGMMV 509 ++ A ++ + ++ Sbjct: 117 EMLRAYEDAHHSLI 130 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 39.1 bits (87), Expect = 0.002 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 10/103 (9%) Frame = +3 Query: 255 LNGELVHGQAIKIE--AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 428 LNG + GQ +K+ A ++ ++ IFVG+L+ + + + F F + + + Sbjct: 120 LNGRHIFGQPMKVNWAYATGQREDTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSDARV 179 Query: 429 V--------RNYGFVHLDATGDVNDAIKELNGMMVTDSP*RCS 533 + R +GFV D AI E+NG V+ RC+ Sbjct: 180 MWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCN 222 Score = 35.1 bits (77), Expect = 0.032 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +3 Query: 327 PTT--KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR----NYGFVHLDATGDVNDAIK 488 PTT ++ GN+ + ++E+F G + C ++R +YGFVH + AI Sbjct: 59 PTTCRSVYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIM 118 Query: 489 ELNGMMVTDSP 521 LNG + P Sbjct: 119 TLNGRHIFGQP 129 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKY--GTVVECDIVRNYGF 211 +++GNLS + T+ DL LF G + E + R+ GF Sbjct: 271 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRDKGF 308 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 +TK+F+G L+ T +R+ F FG VV+ ++ R +GFV+ + G AI Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI 93 Query: 486 KELNG 500 E++G Sbjct: 94 SEMDG 98 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 +TK+F+G L+ T +R+ F FG VV+ ++ R +GFV+ + G AI Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI 93 Query: 486 KELNG 500 E++G Sbjct: 94 SEMDG 98 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 38.7 bits (86), Expect = 0.003 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 8/68 (11%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGDVNDAI 485 + ++FV L+ T +R+LF FG + E ++R+ +GF+ D+ D A+ Sbjct: 6 SAQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Query: 486 KELNGMMV 509 K L+G +V Sbjct: 66 KSLDGKIV 73 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = +3 Query: 345 VGNLTDKTRAPEVRELFQKFGTVV--------ECDIVRNYGFVHLDATGDVNDAIKELNG 500 V NL++ TR P++ ELF FG V + + R +GFV+ + D AI +LNG Sbjct: 217 VTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNG 276 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 38.7 bits (86), Expect = 0.003 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 13/95 (13%) Frame = +3 Query: 255 LNGELVHGQAIKIEAA---KSRKAPSTPTT--KIFVGNLTDKTRAPEVRELFQKFGTVVE 419 L+G G+A+K+ A K K P P T K+FVGNL+ + + F++ G VV Sbjct: 146 LDGTEYLGRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTVTSESLAGAFRECGDVVG 205 Query: 420 CDIV--------RNYGFVHLDATGDVNDAIKELNG 500 +V R YGFV + ++ A++ L+G Sbjct: 206 ARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDG 240 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 8/46 (17%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFV 214 K+F+GNLS T L F + G VV +V R YGFV Sbjct: 178 KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFV 223 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAIKELNG 500 I+VGNL R EV +LF K+G +V+ D+ Y FV + D +DAI +G Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDG 67 Score = 30.3 bits (65), Expect = 0.92 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 I++GNL + ++ LF KYG +V+ D+ Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDL 38 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 8/86 (9%) Frame = +3 Query: 294 EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFV 449 ++A + +P K+FVGNL+ + ++ +LF+ G V +++ R +GFV Sbjct: 86 DSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFV 145 Query: 450 HLDATGDVNDAIKELNGMMVTDSP*R 527 + +V A ++ NG P R Sbjct: 146 TMSTAAEVEAAAQQFNGYEFEGRPLR 171 Score = 33.5 bits (73), Expect = 0.099 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 +++VGNL+ + LF + G VVE ++ + +GFV L ++ +V AI Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 309 Query: 492 LNG 500 LNG Sbjct: 310 LNG 312 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHM 220 K+F+GNLS A L LFE G V +++ R +GFV M Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTM 147 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 G+G ++++GNLS + L LF + G VVE ++ + +GFV + + Q Sbjct: 246 GSGN-RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQ 301 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 8/86 (9%) Frame = +3 Query: 294 EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFV 449 ++A + +P K+FVGNL+ + ++ +LF+ G V +++ R +GFV Sbjct: 86 DSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFV 145 Query: 450 HLDATGDVNDAIKELNGMMVTDSP*R 527 + +V A ++ NG P R Sbjct: 146 TMSTAAEVEAAAQQFNGYEFEGRPLR 171 Score = 33.5 bits (73), Expect = 0.099 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 +++VGNL+ + LF + G VVE ++ + +GFV L ++ +V AI Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 317 Query: 492 LNG 500 LNG Sbjct: 318 LNG 320 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHM 220 K+F+GNLS A L LFE G V +++ R +GFV M Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTM 147 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 G+G ++++GNLS + L LF + G VVE ++ + +GFV + + Q Sbjct: 254 GSGN-RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQ 309 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 8/67 (11%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDA 482 P + F+G L T +R+ F+K+G +VE +V R +GF+ D +++A Sbjct: 5 PEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEA 64 Query: 483 IKELNGM 503 I +NGM Sbjct: 65 IAAMNGM 71 Score = 34.7 bits (76), Expect = 0.043 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 ++ FIG L+ T++ LR FEKYG +VE +V Sbjct: 7 YRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVV 39 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 38.3 bits (85), Expect = 0.003 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 10/103 (9%) Frame = +3 Query: 255 LNGELVHGQAIKIE--AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 428 LNG + GQ IK+ A ++ ++ IFVG+L+ + + + F F + + + Sbjct: 116 LNGRHLFGQPIKVNWAYATGQREDTSSHFNIFVGDLSPEVTDATLYQSFSVFSSCSDARV 175 Query: 429 V--------RNYGFVHLDATGDVNDAIKELNGMMVTDSP*RCS 533 + R +GFV D AI E+NG ++ RC+ Sbjct: 176 MWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCN 218 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = +3 Query: 318 PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR----NYGFVHLDATGDVNDAI 485 PST ++VGN+ + P ++E+F G V ++R +YGFVH AI Sbjct: 55 PST-CRSVYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAI 113 Query: 486 KELNGMMVTDSP 521 LNG + P Sbjct: 114 LSLNGRHLFGQP 125 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 38.3 bits (85), Expect = 0.003 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 9/124 (7%) Frame = +3 Query: 183 NAISSEITVSCTWKTNKSA-ANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLT 359 N+ S +++ W + S A + + E + + A ++ + K+FVGNL Sbjct: 40 NSDSVSFSIAAKWNSPASRFARNVAITSEFEVEEDGFADVAPPKEQSFSADLKLFVGNLP 99 Query: 360 DKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 + ++ +LF+ G V +++ R +GFV + + +V A ++ NG + Sbjct: 100 FNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDG 159 Query: 516 SP*R 527 P R Sbjct: 160 RPLR 163 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 +++VGNL+ + LF + G VVE ++ + +GFV D++ +V +AIK Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKS 264 Query: 492 LNG 500 L+G Sbjct: 265 LDG 267 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 8/66 (12%) Frame = +2 Query: 53 FVHSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYG 208 F P + + K+F+GNL A L LFE G V +++ R +G Sbjct: 76 FADVAPPKEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFG 135 Query: 209 FVHMEN 226 FV M + Sbjct: 136 FVTMSS 141 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 G+G ++++GNLS + L LF + G VVE ++ + +GFV ++ Q Sbjct: 201 GSGN-RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQ 256 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 38.3 bits (85), Expect = 0.003 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +3 Query: 318 PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR----NYGFVHLDATGDVNDAI 485 PST ++VGN+ + P ++E+F G V C ++R +YGFVH AI Sbjct: 50 PST-CRSVYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKSSYGFVHYFDRRSAGLAI 108 Query: 486 KELNGMMVTDSP 521 LNG + P Sbjct: 109 LSLNGRHLFGQP 120 Score = 32.7 bits (71), Expect = 0.17 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 10/103 (9%) Frame = +3 Query: 255 LNGELVHGQAIKIE--AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 428 LNG + GQ IK+ A ++ ++ IFVG+L+ + + F + T + + Sbjct: 111 LNGRHLFGQPIKVNWAYASGQREDTSSHFNIFVGDLSPEVTDAMLFTCFSVYPTCSDARV 170 Query: 429 V--------RNYGFVHLDATGDVNDAIKELNGMMVTDSP*RCS 533 + R +GFV D AI E+ G + RC+ Sbjct: 171 MWDQKTGRSRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCN 213 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/38 (34%), Positives = 27/38 (71%) Frame = +2 Query: 89 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 + T K+F+G++ TE ++RP FE++G V+E ++++ Sbjct: 117 SSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKD 154 Score = 33.5 bits (73), Expect = 0.099 Identities = 13/39 (33%), Positives = 27/39 (69%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 GT FK+F+G+L+ + TE ++ +F ++G V + ++R+ Sbjct: 207 GTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 7/71 (9%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATG 467 R+ T K+FVG+L + EV E+F +FG V + ++R+ GFV + Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKE 262 Query: 468 DVNDAIKELNG 500 AI LNG Sbjct: 263 TAMAAIDGLNG 273 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 T K+FVG++ E+R F++ G V+E ++++ Sbjct: 119 TVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKD 154 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/38 (34%), Positives = 27/38 (71%) Frame = +2 Query: 89 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 + T K+F+G++ TE ++RP FE++G V+E ++++ Sbjct: 117 SSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKD 154 Score = 33.5 bits (73), Expect = 0.099 Identities = 13/39 (33%), Positives = 27/39 (69%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 GT FK+F+G+L+ + TE ++ +F ++G V + ++R+ Sbjct: 207 GTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 7/71 (9%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATG 467 R+ T K+FVG+L + EV E+F +FG V + ++R+ GFV + Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKE 262 Query: 468 DVNDAIKELNG 500 AI LNG Sbjct: 263 TAMAAIDGLNG 273 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 T K+FVG++ E+R F++ G V+E ++++ Sbjct: 119 TVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKD 154 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR---NYGFVHLDATGDVNDAIKELNG 500 ++++VGNL + E+ + F+ FG + + R Y F+ + + D DAI+E++G Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSRDARDAIREVDG 60 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 37.9 bits (84), Expect = 0.005 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +3 Query: 300 AKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGFVHLDATGDV 473 A +R T T IFVG L ++++ F +FG +V I + GFV + Sbjct: 295 AFTRSEGDTINTTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNA 354 Query: 474 NDAIKELNGMMVTDSP*RCSCRR 542 +A+++LNG ++ R S R Sbjct: 355 EEALEKLNGTVIGKQTVRLSWGR 377 Score = 31.1 bits (67), Expect = 0.53 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGRE 244 IF+G L T+ DL+ F ++G +V I + GFV N E Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEE 356 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 37.1 bits (82), Expect = 0.008 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDI-----VRNYGFVHLDATGDVNDAIKELNG 500 I+VGNL R E+ ++F K+G +V+ ++ Y FV + + D DAIK +G Sbjct: 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDG 67 Score = 30.7 bits (66), Expect = 0.70 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 80 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI 193 M G + I++GNL E ++ +F KYG +V+ ++ Sbjct: 1 MSGRFSRSIYVGNLPGDIREHEIEDIFYKYGRIVDIEL 38 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 36.7 bits (81), Expect = 0.011 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 8/57 (14%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 G T KIF+G L TEA+ + F+++GT+ + ++ R +GF+ ++E+ Sbjct: 118 GARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEE 174 Score = 35.1 bits (77), Expect = 0.032 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDV---- 473 T KIFVG L E + F +FGT+ + ++ R +GF+ D+ V Sbjct: 121 TKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVL 180 Query: 474 NDAIKELNGMMV 509 + ELNG MV Sbjct: 181 HKTFHELNGKMV 192 Score = 33.1 bits (72), Expect = 0.13 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E L+ F KYG +VE I+R+ Sbjct: 16 KLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRD 49 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T ++E F K+G +VE I+R+ Sbjct: 16 KLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRD 49 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 36.7 bits (81), Expect = 0.011 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 8/74 (10%) Frame = +3 Query: 312 KAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV------RNYGFVHLDATGD- 470 ++P T K+F+ L+ T +R F+ FG +VE I+ R+ G+ L+ T + Sbjct: 275 ESPPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEE 334 Query: 471 -VNDAIKELNGMMV 509 A+KE+NG ++ Sbjct: 335 AAGTALKEMNGKII 348 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 36.7 bits (81), Expect = 0.011 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = +3 Query: 273 HGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGF 446 HG + ST T IFVG + ++R+ F +FG VV I + GF Sbjct: 302 HGSNGSMGYGSQSDGESTNAT-IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGF 360 Query: 447 VHLDATGDVNDAIKELNGMMVTDSP*RCSCRR 542 V DAI+ LNG ++ + R S R Sbjct: 361 VQFADRKSAEDAIESLNGTVIGKNTVRLSWGR 392 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQ 232 IF+G + + DLR F ++G VV I + GFV + + Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRK 367 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVND 479 T TK+FVG L +T E+R F++FG ++E I+ + YGFV + Sbjct: 14 TTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATR 73 Query: 480 AIKELN 497 A+ + N Sbjct: 74 AVADPN 79 Score = 30.3 bits (65), Expect = 0.92 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+F+G L+ +T ++R FE++G ++E I+ Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVND 479 T TK+FVG L +T E+R F++FG ++E I+ + YGFV + Sbjct: 14 TTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATR 73 Query: 480 AIKELN 497 A+ + N Sbjct: 74 AVADPN 79 Score = 30.3 bits (65), Expect = 0.92 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+F+G L+ +T ++R FE++G ++E I+ Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 36.7 bits (81), Expect = 0.011 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 6/96 (6%) Frame = +3 Query: 234 SAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTV 413 SA ++ G L+ ++ + S P TK++V L+ +T +R+ F++FG + Sbjct: 44 SARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNL 103 Query: 414 VECDIV------RNYGFVHLDATGDVNDAIKELNGM 503 + ++V R GF L + +A+K + GM Sbjct: 104 IHMNMVMDKVANRPKGFAFLRYETE-EEAMKAIQGM 138 Score = 34.7 bits (76), Expect = 0.043 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +2 Query: 62 SNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 S+P S G T K+++ LS +TTE LR FE++G ++ ++V Sbjct: 66 SSPPSSSSGPKT-KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMV 109 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 36.7 bits (81), Expect = 0.011 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 8/74 (10%) Frame = +3 Query: 303 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLD 458 K R+ ++IFVG L+ ++ F ++G + EC I+ R +GF+ Sbjct: 2 KDRENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFT 61 Query: 459 ATGDVNDAIKELNG 500 +DAIK ++G Sbjct: 62 DRRGADDAIKHMHG 75 Score = 35.9 bits (79), Expect = 0.019 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 +IF+G LS TE L F++YG + EC I+ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIM 44 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 36.7 bits (81), Expect = 0.011 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 8/74 (10%) Frame = +3 Query: 303 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLD 458 K R+ ++IFVG L+ ++ F ++G + EC I+ R +GF+ Sbjct: 2 KDRENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFT 61 Query: 459 ATGDVNDAIKELNG 500 +DAIK ++G Sbjct: 62 DRRGADDAIKHMHG 75 Score = 35.9 bits (79), Expect = 0.019 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 +IF+G LS TE L F++YG + EC I+ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIM 44 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 36.3 bits (80), Expect = 0.014 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR 199 K+F+G L +EA+++ LF KYGT+ + I+R Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILR 139 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 K+FVG L EV+ LF K+GT+ + I+R Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILR 139 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+F+G + +E+ L LF+++ V E +I+++ Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 + K+FVG + ++ LFQ+F V E +I+++ Sbjct: 17 SVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 36.3 bits (80), Expect = 0.014 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR 199 K+F+G L +EA+++ LF KYGT+ + I+R Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILR 139 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 K+FVG L EV+ LF K+GT+ + I+R Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILR 139 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+F+G + +E+ L LF+++ V E +I+++ Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 + K+FVG + ++ LFQ+F V E +I+++ Sbjct: 17 SVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKD 52 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 36.3 bits (80), Expect = 0.014 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +2 Query: 83 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 PG T KIF+G L TE+D + FE++GT + ++ R +GF+ ++E+ Sbjct: 104 PGR-TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEE 160 Score = 32.7 bits (71), Expect = 0.17 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 T KIFVG L + + F++FGT + ++ R +GF+ D+ V + Sbjct: 107 TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVL 166 Query: 486 ----KELNGMMV 509 ELNG MV Sbjct: 167 LKTFHELNGKMV 178 Score = 30.7 bits (66), Expect = 0.70 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E L+ F +G V+E I+++ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKD 40 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T ++E F FG V+E I+++ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKD 40 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 36.3 bits (80), Expect = 0.014 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +2 Query: 83 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 PG T KIF+G L TE+D + FE++GT + ++ R +GF+ ++E+ Sbjct: 104 PGR-TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEE 160 Score = 32.7 bits (71), Expect = 0.17 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 T KIFVG L + + F++FGT + ++ R +GF+ D+ V + Sbjct: 107 TRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVL 166 Query: 486 ----KELNGMMV 509 ELNG MV Sbjct: 167 LKTFHELNGKMV 178 Score = 30.7 bits (66), Expect = 0.70 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E L+ F +G V+E I+++ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKD 40 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T ++E F FG V+E I+++ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKD 40 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 36.3 bits (80), Expect = 0.014 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 13/79 (16%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVND 479 TP+ KIFVG L+ T ++E F FG +V+ +V R +GFV D+ N+ Sbjct: 34 TPS-KIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANN 92 Query: 480 AI-----KELNGMMVTDSP 521 A+ KEL+G ++ P Sbjct: 93 AMQAMQNKELDGRIIGVHP 111 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 35.9 bits (79), Expect = 0.019 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 T+ + + N++ +TT DL PLF KYG VV+ I R+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRD 50 Score = 31.1 bits (67), Expect = 0.53 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 8/68 (11%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGDVNDAI 485 T + V N+T +T A ++ LF K+G VV+ I R+ + FV + + A+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 Query: 486 KELNGMMV 509 + L+G +V Sbjct: 75 ERLDGRVV 82 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 35.9 bits (79), Expect = 0.019 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 T+ + + N++ +TT DL PLF KYG VV+ I R+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRD 50 Score = 31.1 bits (67), Expect = 0.53 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 8/68 (11%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGDVNDAI 485 T + V N+T +T A ++ LF K+G VV+ I R+ + FV + + A+ Sbjct: 15 TYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 Query: 486 KELNGMMV 509 + L+G +V Sbjct: 75 ERLDGRVV 82 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 35.9 bits (79), Expect = 0.019 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 12/112 (10%) Frame = +3 Query: 201 ITVSCTWKTNKSAA--NHSELNGELVHGQAIKIEAAKSRKAPST--PTTKIFVGNLTDKT 368 +T+S + K+ N E+NG + ++ + P +I+VGNL Sbjct: 159 VTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDV 218 Query: 369 RAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKELNG 500 + + LF + G VV+ +V R +GFV + +VN AI L+G Sbjct: 219 DSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDG 270 Score = 34.3 bits (75), Expect = 0.057 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 8/52 (15%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 F+I++GNL L LF ++G VV+ +V R +GFV M NE Sbjct: 207 FRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNE 258 Score = 31.1 bits (67), Expect = 0.53 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 9/73 (12%) Frame = +3 Query: 318 PSTPT-TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGD 470 P P K+FVGNL + + LF++ GTV +++ R +GFV + + Sbjct: 107 PEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEE 166 Query: 471 VNDAIKELNGMMV 509 A+++ N V Sbjct: 167 AEKAVEKFNSFEV 179 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+F+GNL L LFE+ GTV +++ N Sbjct: 114 KLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYN 147 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 35.9 bits (79), Expect = 0.019 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 +TK+++G L+ T +++ F F V E ++ R YGFV+ + N AI Sbjct: 30 STKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAI 89 Query: 486 KELNG 500 +NG Sbjct: 90 SAMNG 94 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 35.9 bits (79), Expect = 0.019 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 10/76 (13%) Frame = +3 Query: 303 KSRKAPSTPTT--KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVH 452 ++R+A S P++ +FV +D ++++F +FG V I+ N YG+V Sbjct: 46 ETREASSLPSSISSLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVW 105 Query: 453 LDATGDVNDAIKELNG 500 ++ D A++ +NG Sbjct: 106 FNSKEDAQSAVEAMNG 121 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 35.9 bits (79), Expect = 0.019 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 10/76 (13%) Frame = +3 Query: 303 KSRKAPSTPTT--KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVH 452 ++R+A S P++ +FV +D ++++F +FG V I+ N YG+V Sbjct: 65 ETREASSLPSSISSLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVW 124 Query: 453 LDATGDVNDAIKELNG 500 ++ D A++ +NG Sbjct: 125 FNSKEDAQSAVEAMNG 140 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 35.9 bits (79), Expect = 0.019 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREPFR 253 +IF+G LS + T+ DL F ++G +++C I+ R +GF+ + + E R Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIR 66 Score = 34.7 bits (76), Expect = 0.043 Identities = 16/64 (25%), Positives = 36/64 (56%), Gaps = 8/64 (12%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIK 488 ++IFVG L+ + ++ F +FG +++C I+ R +GF+ ++++I+ Sbjct: 7 SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIR 66 Query: 489 ELNG 500 E++G Sbjct: 67 EMHG 70 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 35.9 bits (79), Expect = 0.019 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 7/86 (8%) Frame = +3 Query: 285 IKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YG 443 ++ E A ++ ++V NL +++E+F FGTV ++R+ G Sbjct: 116 VRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSG 175 Query: 444 FVHLDATGDVNDAIKELNGMMVTDSP 521 FV + +A+ +L+G M+ P Sbjct: 176 FVAFATPEEATEAMSQLSGKMIESKP 201 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 7/94 (7%) Frame = +3 Query: 255 LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 LN + V+ + A T T ++V NL + T +++ F ++G + +++ Sbjct: 3 LNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMK 62 Query: 435 N-------YGFVHLDATGDVNDAIKELNGMMVTD 515 + +GFV+ + D A++ LNG D Sbjct: 63 DGEGKSKGFGFVNFENADDAARAVESLNGHKFDD 96 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMEN 226 +++ NL++ TT+ DL+ F +YG + ++++ +GFV+ EN Sbjct: 31 VYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFEN 78 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 35.9 bits (79), Expect = 0.019 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR---NYGFVHLDATGDVNDAIKELNG 500 ++++VGNL + E+ + F+ FG V + R Y F+ + D DAI+ L+G Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDG 60 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 35.9 bits (79), Expect = 0.019 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 8/100 (8%) Frame = +3 Query: 234 SAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTV 413 S E+ E G+ ++E K S +++VGNL + E+ ++F + GTV Sbjct: 84 SVEEEEEVEEEGDEGEE-EVEEEKQTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTV 142 Query: 414 VECDIV--------RNYGFVHLDATGDVNDAIKELNGMMV 509 V+ IV R +GFV + + + +A++ N + Sbjct: 143 VDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQI 182 Score = 31.5 bits (68), Expect = 0.40 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 8/56 (14%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGRE 244 ++++GNL T ++L +F + GTVV+ IV R +GFV M + + +E Sbjct: 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKE 172 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.9 bits (79), Expect = 0.019 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 KIF+G +S T E LR F KYG VV+ I+ Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKII 66 Score = 33.5 bits (73), Expect = 0.099 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 ++KIFVG ++ T +RE F K+G VV+ I+ R + FV +T + ++A+ Sbjct: 33 SSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAM 92 Query: 486 KELNG 500 +L+G Sbjct: 93 -QLDG 96 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 35.9 bits (79), Expect = 0.019 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 8/51 (15%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVHMENEQ 232 +F+ L+ T + DL +F ++GTVV D++R+ Y F+ EN++ Sbjct: 245 LFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKE 295 Score = 33.9 bits (74), Expect = 0.075 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNY 440 P +FV L T ++ +F +FGTVV D++R++ Sbjct: 241 PDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDF 278 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 35.5 bits (78), Expect = 0.024 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNY-------GFVHLDATGDVNDAIKELN 497 +FV NL +T+ P + + F+K G VV ++ N GFV + + +A+++ N Sbjct: 129 LFVANLPYETKIPNIIDFFKKVGEVVRVQLIVNLKGKLVGCGFVEFASVNEAEEALQKKN 188 Query: 498 G 500 G Sbjct: 189 G 189 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGFVHLDATGDVNDAIKELNGMM 506 T IFVG L ++++ F +FG +V I + GFV + +A+++LNG + Sbjct: 304 TTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTV 363 Query: 507 VTDSP*RCSCRR 542 + R S R Sbjct: 364 IGKQTVRLSWGR 375 Score = 31.1 bits (67), Expect = 0.53 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGRE 244 IF+G L T+ DL+ F ++G +V I + GFV N E Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEE 354 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVND 479 T TK+FVG L +T E+R F +FG ++E I+ + YGFV + Sbjct: 14 TTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATR 73 Query: 480 AIKELN 497 A+ + N Sbjct: 74 AVADPN 79 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 35.1 bits (77), Expect = 0.032 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIK 488 +K+F+G L+ T + E F K G VVE IV + +GFV + + A+ Sbjct: 34 SKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALM 93 Query: 489 ELNGMMV 509 E NG + Sbjct: 94 EFNGQQL 100 Score = 33.9 bits (74), Expect = 0.075 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+FIG LS TTE L F K G VVE IV Sbjct: 35 KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIV 66 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T +++ F +FG V++ I+ R +GFV + DAI+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 492 LNG 500 +NG Sbjct: 67 MNG 69 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T +++ F +FG V++ I+ R +GFV + DAI+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 492 LNG 500 +NG Sbjct: 67 MNG 69 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T +++ F +FG V++ I+ R +GFV + DAI+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 492 LNG 500 +NG Sbjct: 67 MNG 69 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T +++ F +FG V++ I+ R +GFV + DAI+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 492 LNG 500 +NG Sbjct: 67 MNG 69 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 35.1 bits (77), Expect = 0.032 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 ++++GNLS TT+ LR F YG VV+ ++R+ Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRD 37 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.1 bits (77), Expect = 0.032 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 8/79 (10%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVN 476 ++P++K+F+G L+ +++ F FG V E I R +GFV GD Sbjct: 37 ASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDAL 96 Query: 477 DAIKELNGMMVTDSP*RCS 533 A ++G + P R S Sbjct: 97 SAKDAMDGKGLLGRPLRIS 115 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 35.1 bits (77), Expect = 0.032 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TKIFVG L +T+ +R F++FG +VE ++ Sbjct: 19 TKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVI 54 Score = 30.7 bits (66), Expect = 0.70 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 KIF+G L+ +T +R FE++G +VE ++ Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVEAVVI 54 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 35.1 bits (77), Expect = 0.032 Identities = 26/77 (33%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 78 KCRAPVLSKSSSGT---FLIKPQKPILDRYSKNTVRS*NAISSEITVSCTWKTNKSAANH 248 +C + +S + T +K Q + DR N V NA ITV C Sbjct: 509 QCHFGLFQESPTATDQELALKFQWSVADRSLSNFVPILNATKENITVKCCAGKGIPKVVS 568 Query: 249 SELNGELVHGQAIKIEA 299 ELNGELV G IK +A Sbjct: 569 LELNGELVEGNIIKGQA 585 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 35.1 bits (77), Expect = 0.032 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 +K+F+G ++ +T+E L+ F +YG V+E + R +GFV N+ Sbjct: 6 YKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFAND 57 Score = 35.1 bits (77), Expect = 0.032 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 T KIF+G LS TTE + + FE++G + ++ R +GFV ++E Sbjct: 119 TKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSE 171 Score = 33.5 bits (73), Expect = 0.099 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 8/93 (8%) Frame = +3 Query: 306 SRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDA 461 S ++ T KIFVG L+ T E + F++FG + ++ R +GFV D+ Sbjct: 111 SSNGVTSRTKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDS 170 Query: 462 TGDVNDAIKELNGMMVTDSP*RCSCRRVVSGSG 560 V + + + N ++D R +R + G Sbjct: 171 EDSV-EVVMQSNFHELSDK--RVEVKRAIPKEG 200 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 35.1 bits (77), Expect = 0.032 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +3 Query: 327 PTT--KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR----NYGFVHLDATGDVNDAIK 488 PTT ++ GN+ + ++E+F G + C ++R +YGFVH + AI Sbjct: 59 PTTCRSVYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIM 118 Query: 489 ELNGMMVTDSP 521 LNG + P Sbjct: 119 TLNGRHIFGQP 129 Score = 32.3 bits (70), Expect = 0.23 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 14/107 (13%) Frame = +3 Query: 255 LNGELVHGQAIKIE--AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVV---- 416 LNG + GQ +K+ A ++ ++ IFVG+L+ + + + F F + Sbjct: 120 LNGRHIFGQPMKVNWAYATGQREDTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSSYYR 179 Query: 417 ECDIV--------RNYGFVHLDATGDVNDAIKELNGMMVTDSP*RCS 533 + ++ R +GFV D AI E+NG V+ RC+ Sbjct: 180 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCN 226 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKY--GTVVECDIVRNYGF 211 +++GNLS + T+ DL LF G + E + R+ GF Sbjct: 275 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRDKGF 312 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 34.7 bits (76), Expect = 0.043 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E LR F YG VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 Score = 33.9 bits (74), Expect = 0.075 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 T KIFVG L E + F +FGT+ + ++ R +GF+ D+ V+ + Sbjct: 109 TKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVL 168 Query: 486 ----KELNGMMV 509 ELNG +V Sbjct: 169 HKTFHELNGKLV 180 Score = 31.9 bits (69), Expect = 0.30 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY 205 G T KIF+G L TE + + F+++GT+ + ++ ++ Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDH 145 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T +R+ F +G VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 34.7 bits (76), Expect = 0.043 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E LR F YG VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 Score = 33.9 bits (74), Expect = 0.075 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 T KIFVG L E + F +FGT+ + ++ R +GF+ D+ V+ + Sbjct: 109 TKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVL 168 Query: 486 ----KELNGMMV 509 ELNG +V Sbjct: 169 HKTFHELNGKLV 180 Score = 31.9 bits (69), Expect = 0.30 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY 205 G T KIF+G L TE + + F+++GT+ + ++ ++ Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDH 145 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T +R+ F +G VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 34.7 bits (76), Expect = 0.043 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+FIG +S T E LR F YG VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 Score = 33.9 bits (74), Expect = 0.075 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 T KIFVG L E + F +FGT+ + ++ R +GF+ D+ V+ + Sbjct: 109 TKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVL 168 Query: 486 ----KELNGMMV 509 ELNG +V Sbjct: 169 HKTFHELNGKLV 180 Score = 31.9 bits (69), Expect = 0.30 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY 205 G T KIF+G L TE + + F+++GT+ + ++ ++ Sbjct: 106 GGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDH 145 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ T +R+ F +G VVE I+R+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRD 40 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 34.7 bits (76), Expect = 0.043 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 9/61 (14%) Frame = +2 Query: 86 GTGTF-KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 238 G TF K+F+G L+ +T LR FE+YG ++E ++ + YGFV + + Sbjct: 19 GDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAA 78 Query: 239 R 241 R Sbjct: 79 R 79 Score = 32.7 bits (71), Expect = 0.17 Identities = 12/36 (33%), Positives = 25/36 (69%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T++ +R+ F+++G ++E ++ Sbjct: 21 TTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVI 56 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 34.3 bits (75), Expect = 0.057 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 8/58 (13%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREPFR 253 IF+ TT+ +L+ FE YG + EC +V + YGFV + + RE + Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALK 467 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 34.3 bits (75), Expect = 0.057 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV------RNYGFVHLDAT-GDVNDAIKEL 494 K++VGNL T+ +R F KFGT+V ++ RN F L T G+ DA Sbjct: 213 KVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSF 272 Query: 495 NG 500 NG Sbjct: 273 NG 274 Score = 28.3 bits (60), Expect = 3.7 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 11/97 (11%) Frame = +3 Query: 252 ELNGELVHGQAIKIE---AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVEC 422 E E+V G+A + +K+ +++V N+ ++ ++FQ FGTV+ Sbjct: 78 EKEEEVVKGEAEPNKDSVVSKAEPVKKPRPCELYVCNIPRSYDIAQLLDMFQPFGTVISV 137 Query: 423 DIVRN--------YGFVHLDATGDVNDAIKELNGMMV 509 ++ RN G+V + + AI L+G V Sbjct: 138 EVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEV 174 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+++GNL T LR F K+GT+V ++ + Sbjct: 213 KVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHD 246 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 33.9 bits (74), Expect = 0.075 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVE 184 K+++ +S TE D+R +FEKYG V E Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTE 138 Score = 31.5 bits (68), Expect = 0.40 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 7/69 (10%) Frame = +3 Query: 318 PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVEC-------DIVRNYGFVHLDATGDVN 476 P P K++V L +T EV E+F ++G + + I R Y FV Sbjct: 204 PDNP--KLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYAFVQFSCKEMAL 261 Query: 477 DAIKELNGM 503 AIK LNG+ Sbjct: 262 AAIKALNGL 270 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.9 bits (74), Expect = 0.075 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGF 211 +++G+L+ +TTE+DL LF +YG + + + GF Sbjct: 20 LWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGF 55 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/42 (26%), Positives = 24/42 (57%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHL 455 + ++VG+LT +T ++ ELF ++G + + + GF + Sbjct: 17 SNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFI 58 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 33.9 bits (74), Expect = 0.075 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T +R F++FG +VE ++ Sbjct: 4 TTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 80 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 M T K+F+G L+ +T + LR FE++G +VE ++ Sbjct: 1 MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 33.9 bits (74), Expect = 0.075 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T +R F++FG +VE ++ Sbjct: 4 TTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 80 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 M T K+F+G L+ +T + LR FE++G +VE ++ Sbjct: 1 MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 33.9 bits (74), Expect = 0.075 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR---NYGFVHLDATGDVNDAIKELN 497 T+++VGNL + E+ + F+ FG + + R Y F+ D D DAI L+ Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALD 59 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 33.9 bits (74), Expect = 0.075 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR---NYGFVHLDATGDVNDAIKELN 497 T+++VGNL + E+ + F+ FG + + R Y F+ D D DAI L+ Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALD 59 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.5 bits (73), Expect = 0.099 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAI 485 ++K+F+G + +RE F K+G VV+ ++ R +GFV ++ + AI Sbjct: 39 SSKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAI 98 Query: 486 KELNG 500 + L+G Sbjct: 99 QALDG 103 Score = 30.7 bits (66), Expect = 0.70 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+FIG ++ E LR F KYG VV+ ++ Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVI 72 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 33.5 bits (73), Expect = 0.099 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDA 461 KIFVGNL + PE E F++FG + +++ + V +A Sbjct: 166 KIFVGNLPTWIKKPEFEEFFRQFGPIENVILIKGHHEVEKNA 207 >At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 309 Score = 33.5 bits (73), Expect = 0.099 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 104 IFIGNL-SDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 +F+ N +D T DL FE YG +V I RN+ F+ E ++ Sbjct: 58 LFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQE 101 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +3 Query: 258 NGELVHGQAIKIEAAKSRKAPST---PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 428 + ++ G+ ++I+ R + S+ T KIFVG + E +E F +FG + E I Sbjct: 102 DNHIIIGKQVEIKRTIPRGSMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQI 161 Query: 429 VRNY 440 +R++ Sbjct: 162 MRDH 165 Score = 31.5 bits (68), Expect = 0.40 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 KIF+G L+ +TT A+ F KYG + + I+++ Sbjct: 43 KIFVGGLARETTSAEFLKHFGKYGEITDSVIMKD 76 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 KIFVG L +T + E + F K+G + + I+++ Sbjct: 43 KIFVGGLARETTSAEFLKHFGKYGEITDSVIMKD 76 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 T KIF+G L T+ + R FE YG V + I+ R +GFV ++E Sbjct: 109 TKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSE 161 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 K+F+G +S +T E LR F YG V + ++R+ Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRD 40 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 6/82 (7%) Frame = +3 Query: 294 EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV------RNYGFVHL 455 +++ A + ++V N+ + T +++ELFQ+ G V + R++GFVH Sbjct: 279 KSSPEHSAAAAQVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHY 338 Query: 456 DATGDVNDAIKELNGMMVTDSP 521 A+K+ V P Sbjct: 339 AERSSALKAVKDTERYEVNGQP 360 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 80 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 +P G+ ++FIG L E DLR L E+ G + E ++++ Sbjct: 111 LPPHGS-EVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKD 150 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 33.1 bits (72), Expect = 0.13 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 208 +++G + TE DL +F +YG +V+ +++R+ G Sbjct: 38 VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKG 72 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 33.1 bits (72), Expect = 0.13 Identities = 30/108 (27%), Positives = 42/108 (38%), Gaps = 2/108 (1%) Frame = +3 Query: 225 TNKSAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKF 404 T K AA + + NG A S + + IFVG L ++ + F F Sbjct: 291 TPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDF 350 Query: 405 GTVVECDIV--RNYGFVHLDATGDVNDAIKELNGMMVTDSP*RCSCRR 542 G VV I + GFV +AI LNG ++ + R S R Sbjct: 351 GEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGR 398 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 9/61 (14%) Frame = +2 Query: 86 GTGTF-KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVG 238 G TF K+F+G L+ +T LR F++YG ++E ++ + YGFV + + Sbjct: 19 GDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAA 78 Query: 239 R 241 R Sbjct: 79 R 79 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T++ +R F ++G ++E ++ Sbjct: 21 TTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVI 56 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR 199 K+F+G L +E +++ LF +YGT+ + I+R Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 142 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 P K+FVG L EV+ LF ++GT+ + I+R Sbjct: 107 PEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 142 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/76 (21%), Positives = 33/76 (43%), Gaps = 8/76 (10%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKEL 494 +F+ N+ + E+ FQ FG V+ + + +GF+ D+ +AI + Sbjct: 341 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAINTM 400 Query: 495 NGMMVTDSP*RCSCRR 542 NG ++ + +R Sbjct: 401 NGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR 199 K+F+G L +E +++ LF +YGT+ + I+R Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 133 Score = 31.1 bits (67), Expect = 0.53 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 K+FVG L EV+ LF ++GT+ + I+R Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 133 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/76 (21%), Positives = 33/76 (43%), Gaps = 8/76 (10%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKEL 494 +F+ N+ + E+ FQ FG V+ + + +GF+ D+ +AI + Sbjct: 332 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAINTM 391 Query: 495 NGMMVTDSP*RCSCRR 542 NG ++ + +R Sbjct: 392 NGCQLSGKKLKVQLKR 407 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = +2 Query: 83 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 27 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEE 85 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 12/70 (17%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIK- 488 KIFVG L E ++ F +FG + + ++ R +GF+ D+ V+ ++ Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 93 Query: 489 ---ELNGMMV 509 ELNG MV Sbjct: 94 TFHELNGKMV 103 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = +2 Query: 83 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 100 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEE 158 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 12/70 (17%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIK- 488 KIFVG L E ++ F +FG + + ++ R +GF+ D+ V+ ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 166 Query: 489 ---ELNGMMV 509 ELNG MV Sbjct: 167 TFHELNGKMV 176 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ +T +R+ F FG V+E I+++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKD 40 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = +2 Query: 83 PG-TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQ 232 PG + + KIF+G L+ TEA+ + F ++G + + ++ R +GF+ ++E+ Sbjct: 100 PGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEE 158 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 12/70 (17%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIK- 488 KIFVG L E ++ F +FG + + ++ R +GF+ D+ V+ ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQK 166 Query: 489 ---ELNGMMV 509 ELNG MV Sbjct: 167 TFHELNGKMV 176 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 K+F+G ++ +T +R+ F FG V+E I+++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKD 40 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 32.7 bits (71), Expect = 0.17 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 18/93 (19%) Frame = +3 Query: 276 GQAIKIEAAKSRK--------APS-TPTTKIFVGNLTDKTRAPEVRELFQ-KFGTVVECD 425 G+ +K++ AK++K PS PT +FV NL + RA ++E F G VV + Sbjct: 161 GRRLKVDYAKTKKKKTYAPRETPSPVPTFNLFVANLAFEARAKHLKEFFDADTGNVVSTE 220 Query: 426 IV--------RNYGFVHLDATGDVNDAIKELNG 500 ++ YGFV A+ E G Sbjct: 221 VIFHENPRRSSGYGFVSFKTKKQAEAALIEFQG 253 Score = 30.7 bits (66), Expect = 0.70 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI-----VRNYGFVHME 223 ++ N+ +T D+R LFEKYG+V++ ++ RN G V +E Sbjct: 95 RLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIE 140 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 7/75 (9%) Frame = +3 Query: 318 PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFVHLDATGDVN 476 P+ + ++V NL++ +RE+F +G +V ++ + +GFV + Sbjct: 299 PNMRWSNLYVKNLSESMNETRLREIFGCYGQIVSAKVMCHENGRSKGFGFVCFSNCEESK 358 Query: 477 DAIKELNGMMVTDSP 521 A + LNG +V P Sbjct: 359 QAKRYLNGFLVDGKP 373 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENEQVGREPFR 253 +++ NLS+ E LR +F YG +V ++ + +GFV N + ++ R Sbjct: 306 LYVKNLSESMNETRLREIFGCYGQIVSAKVMCHENGRSKGFGFVCFSNCEESKQAKR 362 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 F+IF+G+L +E DL+ +F G V E I++N Sbjct: 214 FEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKN 248 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 32.3 bits (70), Expect = 0.23 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 8/80 (10%) Frame = +3 Query: 294 EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNY--------GFV 449 E SR S+ + + + NL R ++R+ F++FG + + + RNY GFV Sbjct: 34 ERPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFV 93 Query: 450 HLDATGDVNDAIKELNGMMV 509 D +A+K +N ++ Sbjct: 94 KYRYAEDAAEAMKRMNHKVI 113 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 32.3 bits (70), Expect = 0.23 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGFVHLDATGDVNDAIKELNG 500 P+ ++VGNL E+ + F +FG + R+Y FV+ + D AI+ L G Sbjct: 21 PSRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQG 80 Query: 501 MMVTDSP*R 527 ++ +P R Sbjct: 81 FPLSGNPLR 89 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 32.3 bits (70), Expect = 0.23 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 9/78 (11%) Frame = +3 Query: 315 APSTPTTKIFVGNLTDKTRAPEVRELFQKFG-TVVECDIV--------RNYGFVHLDATG 467 AP K++V NL K R+ +RELF V +V YGFV Sbjct: 188 APGDTRHKLYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATRE 247 Query: 468 DVNDAIKELNGMMVTDSP 521 + +AI +LNG + P Sbjct: 248 EAENAITKLNGKEIMGRP 265 >At1g72880.2 68414.m08430 acid phosphatase survival protein SurE, putative similar to Swiss-Prot:P36664 acid phosphatase surE (EC 3.1.3.2) (Stationary-phase survival protein surE) [Escherichia coli O157:H7]; contains Pfam domain PF01975: Survival protein SurE Length = 385 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 213 CTWKTNKSAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVG 350 C +T+KSA+ HS GE + ++K++ A + + TP I +G Sbjct: 94 CAPQTDKSASAHSTTPGETIAVSSVKLKGATAFEVSGTPVDCISLG 139 >At1g72880.1 68414.m08429 acid phosphatase survival protein SurE, putative similar to Swiss-Prot:P36664 acid phosphatase surE (EC 3.1.3.2) (Stationary-phase survival protein surE) [Escherichia coli O157:H7]; contains Pfam domain PF01975: Survival protein SurE Length = 385 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 213 CTWKTNKSAANHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVG 350 C +T+KSA+ HS GE + ++K++ A + + TP I +G Sbjct: 94 CAPQTDKSASAHSTTPGETIAVSSVKLKGATAFEVSGTPVDCISLG 139 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 31.9 bits (69), Expect = 0.30 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 8/77 (10%) Frame = +3 Query: 294 EAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFV 449 E+ + + P+T +FV L+ +T + +R F +FG V + +V + +GFV Sbjct: 43 ESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFV 102 Query: 450 HLDATGDVNDAIKELNG 500 D I ++G Sbjct: 103 RYATLEDSAKGIAGMDG 119 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 31.9 bits (69), Expect = 0.30 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 77 KMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNY 205 + P +IF+ + +E+D R FE+YG + + + ++Y Sbjct: 84 RQPAKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMPKDY 126 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 KIFVG L + ++R+ F +FG + + I ++ Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKD 274 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 31.9 bits (69), Expect = 0.30 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 IF+ L TT +L+ FE YG + EC +V Sbjct: 165 IFVRGLGWDTTHENLKAAFEVYGEITECSVV 195 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.9 bits (69), Expect = 0.30 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G ++++GNL +E DLR +FE +G+V + R+ Sbjct: 283 GARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD 319 Score = 31.1 bits (67), Expect = 0.53 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVV-------ECDIVRNYGFVHLDATGDVNDAIKEL 494 +++VGNL ++R++F+ FG+V E + + +GFV D +A+ L Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETGLCKGFGFVQFARLEDARNAL-NL 344 Query: 495 NGMM 506 NG + Sbjct: 345 NGQL 348 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 31.9 bits (69), Expect = 0.30 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +2 Query: 98 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENE 229 F ++GNL T E DL+ F ++G V+ ++ ++ F ++ E Sbjct: 8 FTCYVGNLESDTEENDLKNAFSQFGDVIHSNVRFSFHFSLIDYE 51 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +3 Query: 342 FVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLD 458 +VGNL T +++ F +FG V+ ++ ++ F +D Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDVIHSNVRFSFHFSLID 49 >At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 389 Score = 31.9 bits (69), Expect = 0.30 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 419 +K P T IFV NL P++ ELF+ FG + E Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKE 308 >At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 427 Score = 31.9 bits (69), Expect = 0.30 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 419 +K P T IFV NL P++ ELF+ FG + E Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKE 308 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 31.5 bits (68), Expect = 0.40 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 110 IGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHME 223 + NLS T LR LF GTVV+C I + ++E Sbjct: 355 VSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIE 392 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 345 VGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLD 458 V NL+ ++R+LF GTVV+C I + +++ Sbjct: 355 VSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIE 392 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 31.5 bits (68), Expect = 0.40 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 327 PTTKIFVGNLTD-KTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKELNGM 503 PT +FV N +TR ++ F+ +G V+ + RN+ FV D A+ + Sbjct: 67 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 126 Query: 504 MVTD 515 + D Sbjct: 127 KLLD 130 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 95 TFKIFIGNLSD-KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQ 232 T +F+ N +T E D+ FE YG V+ + RN+ FV ++ Sbjct: 68 TKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQE 114 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 31.5 bits (68), Expect = 0.40 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 T KIF+G L T + R FE YG V + I+ R +GFV ++E Sbjct: 109 TKKIFVGGLPPALTSDEFRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSE 161 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 434 K+F+G ++ T +RE F FG V++ ++R Sbjct: 7 KLFIGGISWDTDENLLREYFSNFGEVLQVTVMR 39 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 31.1 bits (67), Expect = 0.53 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVND 479 T TKI+VG L TR + F++FG ++ ++V + YGFV Sbjct: 10 TTFTKIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATR 69 Query: 480 AIKELN 497 A K+ N Sbjct: 70 ACKDPN 75 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 31.1 bits (67), Expect = 0.53 Identities = 24/91 (26%), Positives = 36/91 (39%), Gaps = 3/91 (3%) Frame = +3 Query: 279 QAIKIEAAKSRKAPSTPT-TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGFV 449 Q + + S PT T IFVG + +++ +F +FG +V I + GFV Sbjct: 259 QPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFV 318 Query: 450 HLDATGDVNDAIKELNGMMVTDSP*RCSCRR 542 A+ LNG + R S R Sbjct: 319 QYANRACAEQALSVLNGTQLGGQSIRLSWGR 349 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMEN 226 IF+G + TE DL+ +F ++G +V I + GFV N Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYAN 322 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 31.1 bits (67), Expect = 0.53 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 8/101 (7%) Frame = +3 Query: 243 NHSELNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVEC 422 + +E+ G L+ + + E +K++K K+ + NL + + +++ +F G V + Sbjct: 307 HQTEVKGNLIWARQLGGEGSKAQK------WKLIIRNLPFQAKPSDIKVVFSAVGFVWDV 360 Query: 423 DIVRNY--------GFVHLDATGDVNDAIKELNGMMVTDSP 521 I +N+ FV D +AIK+ NG M P Sbjct: 361 FIPKNFETGLPKGFAFVKFTCKKDAANAIKKFNGHMFGKRP 401 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.1 bits (67), Expect = 0.53 Identities = 21/96 (21%), Positives = 40/96 (41%), Gaps = 9/96 (9%) Frame = +3 Query: 255 LNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV- 431 LN +HG+ I++ A K +F+GNL + + F FG + + Sbjct: 86 LNMIKLHGKPIRVNKASQDKKSLDVGANLFIGNLDPDVDEKLLYDTFSAFGVIASNPKIM 145 Query: 432 --------RNYGFVHLDATGDVNDAIKELNGMMVTD 515 R +GF+ D+ + AI+ + G +++ Sbjct: 146 RDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSN 181 Score = 28.3 bits (60), Expect = 3.7 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVEC--------DIVRNYGFVHLDATGDVNDAIKEL 494 ++VG L + + ELF + G VV ++ +NYGF+ + D + AIK L Sbjct: 27 VYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVL 86 Query: 495 NGMMVTDSP*R 527 N + + P R Sbjct: 87 NMIKLHGKPIR 97 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T +++ F++FG ++E ++ Sbjct: 10 TTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 241 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAAR 68 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T +++ F++FG ++E ++ Sbjct: 10 TTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 241 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAAR 68 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L +T +++ F++FG ++E ++ Sbjct: 10 TTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 241 K+F+G L+ +T + ++ FE++G ++E ++ + YGFV + R Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAAR 68 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 31.1 bits (67), Expect = 0.53 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVGREPFR 253 +F+G L T+ L+ +F +YG +V I + GFV + E R Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALR 314 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 30.7 bits (66), Expect = 0.70 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--RNYGFVHLDATGDVNDAIKELNGMM 506 T IFVG L E++ +F +FG ++ I + GFV A+ LNG Sbjct: 260 TTIFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQ 319 Query: 507 VTDSP*RCSCRR 542 + R S R Sbjct: 320 LGGQSIRLSWGR 331 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 30.7 bits (66), Expect = 0.70 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 8/74 (10%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTV--VECDIVRN------YGFVHLDATGDVNDAI 485 +T +++GN++ T ++ ELF + G + + + +N + FV + D DA+ Sbjct: 33 STTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTEDAV 92 Query: 486 KELNGMMVTDSP*R 527 K ++G ++ D P R Sbjct: 93 KYISGTILDDRPIR 106 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 30.7 bits (66), Expect = 0.70 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 8/70 (11%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGDVNDAIKE 491 ++F G+L ++ + + F +F T ++R+ YGFV D+ A+KE Sbjct: 138 RLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAALKE 197 Query: 492 LNGMMVTDSP 521 +NG V + P Sbjct: 198 MNGKYVGNRP 207 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREPFR 253 KIF+ L +TT L +FE YG + EC +V + +GFV + + +E + Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALK 163 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGREPFR 253 KIF+ L +TT L +FE YG + EC +V + +GFV + + +E + Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALK 163 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 30.3 bits (65), Expect = 0.92 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = +3 Query: 339 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAIKELN 497 ++VG L VR +F +G+V+ IV + YGFV +DAI++++ Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSVRGKCYGFVTFSNRRSADDAIEDMD 68 Query: 498 GMMV 509 G + Sbjct: 69 GKSI 72 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQ 232 +++G L TE +R +F YG+V+ IV + YGFV N + Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSVRGKCYGFVTFSNRR 58 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 30.3 bits (65), Expect = 0.92 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = +3 Query: 285 IKIEAAKSRKAP-STP-----TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 + +E +RKAP +TP T +++G + E+ F +FGTV + RN Sbjct: 38 LPLEGGPARKAPVTTPPLQNKATVLYIGRIPHGFYETEIEAFFSQFGTVKRVRVARN 94 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNY--------GFVHLDATGDVNDAIK 488 T + V NL R ++R+ F++FG V + + R+Y GFV D DA Sbjct: 36 TSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKH 95 Query: 489 ELNGMMV 509 ++G ++ Sbjct: 96 HMDGYLL 102 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDA 482 P ++V L+ + ++ + F K G V + +V R +GF+ + + GD N Sbjct: 43 PGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRC 102 Query: 483 IKELN 497 I+ L+ Sbjct: 103 IRSLD 107 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDA 482 P ++V L+ + ++ + F K G V + +V R +GF+ + + GD N Sbjct: 73 PGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRC 132 Query: 483 IKELN 497 I+ L+ Sbjct: 133 IRSLD 137 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 255 LNGELVHGQAIKIEAAKSRKAPST 326 LNG++V+G+ I +E AK +AP+T Sbjct: 127 LNGKIVNGRLIFVETAKEVEAPTT 150 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 354 LTDKTRAPEVRELFQKFGTVV---ECDIVRNYGFVHLDATGDVNDAIKELNGMMV 509 L+ T +R+LF F ++ + + +GF+ ++ D A+K LNG +V Sbjct: 78 LSAYTTDQSLRQLFAPFARLIKDQQTQRPKGFGFITFESEDDAQKALKALNGKIV 132 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 29.5 bits (63), Expect = 1.6 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 9/84 (10%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQ-KFGTVVECDIV--------RNYGFVHLDA 461 +K + P IFVG+L ++E F+ + +V +V + YGFV Sbjct: 108 QKVDAGPDHSIFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAE 167 Query: 462 TGDVNDAIKELNGMMVTDSP*RCS 533 + N A+ E+NG+ + P R S Sbjct: 168 ESERNRAMAEMNGLYCSTRPMRIS 191 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/71 (21%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Frame = +3 Query: 321 STPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVN 476 S ++++GN+ ++ +L ++ G V + ++ R +GF + + D N Sbjct: 72 SEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDAN 131 Query: 477 DAIKELNGMMV 509 +++LNG V Sbjct: 132 AVVEKLNGNTV 142 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 241 G ++ F+G L+ T + L F +YG V++ I+ R +GFV ++E+ + Sbjct: 4 GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 Query: 242 E 244 + Sbjct: 64 D 64 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T + F ++G V++ I+ R +GFV + DAI+ Sbjct: 9 RCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEG 68 Query: 492 LNG 500 +NG Sbjct: 69 MNG 71 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVGR 241 G ++ F+G L+ T + L F +YG V++ I+ R +GFV ++E+ + Sbjct: 4 GDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 Query: 242 E 244 + Sbjct: 64 D 64 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDATGDVNDAIKE 491 + FVG L T + F ++G V++ I+ R +GFV + DAI+ Sbjct: 9 RCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEG 68 Query: 492 LNG 500 +NG Sbjct: 69 MNG 71 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTV 178 G K+++GNL +E LR +FE +G V Sbjct: 261 GPADRKLYVGNLHFNMSELQLRQIFEAFGPV 291 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 +IFVG L +VREL + FG + D+V++ Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 +IFVG L +VREL + FG + D+V++ Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 202 G +IF+G L TE+ +R L E +G + D+V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 336 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 437 +IFVG L +VREL + FG + D+V++ Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKD 393 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 92 GTFKIFIGNLSDKTTEADLRPLF 160 G +++IGNL+ TTE D+R LF Sbjct: 260 GYNRVYIGNLAWDTTERDIRKLF 282 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +3 Query: 222 KTNKSAANHSELN-GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQ 398 K NK+ E N E V + I++ + P K++VG + ++ E+R F+ Sbjct: 124 KVNKTPKKAEEGNVEEKVKVEEIEVNTDNKEEDGVVPN-KLYVGGIPYQSTEDEIRSYFR 182 Query: 399 KFGTVVECD 425 G +++ D Sbjct: 183 SCGVIIKVD 191 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+FI L+ TT LR LF YG + E ++ Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVI 107 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 101 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 K+FI L+ TT LR LF YG + E ++ Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVI 107 >At3g14770.1 68416.m01867 nodulin MtN3 family protein similar to MtN3 GI:1619602 (root nodule development) from [Medicago truncatula] Length = 236 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 26 FNLCYILLFFVHSNP*SKMPGTG-TFKIF 109 F LCYI+LF +H++ +KM G F +F Sbjct: 88 FQLCYIILFIMHTDKKNKMKMLGLLFVVF 116 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = +2 Query: 95 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENE 229 T KIF+G L E +L+ F YG ++E I+ R +GFV + E Sbjct: 156 TRKIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTE 208 Score = 27.9 bits (59), Expect = 4.9 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 8/70 (11%) Frame = +2 Query: 59 HSNP*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFV 214 H + S M G K+F+G +S +TT F K+G VV+ I+ R +GFV Sbjct: 55 HRHSSSSMSSPG--KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFV 112 Query: 215 HMENEQVGRE 244 + V + Sbjct: 113 TFADSAVAEK 122 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 291 IEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 ++ S + S+P K+FVG ++ +T A F KFG VV+ I+ Sbjct: 53 VDHRHSSSSMSSPG-KLFVGGVSWETTAETFANYFGKFGEVVDSVIM 98 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 28.3 bits (60), Expect = 3.7 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 11/71 (15%) Frame = +3 Query: 330 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-----------RNYGFVHLDATGDVN 476 TT ++VGNL+ K + F +FG + I+ RN GFV D Sbjct: 178 TTNLYVGNLSPKVDENFLLRTFGRFGPIASVKIMWPRTDEEKRRQRNCGFVSFMNRADGQ 237 Query: 477 DAIKELNGMMV 509 A E+ G++V Sbjct: 238 AAKDEMQGIIV 248 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 28.3 bits (60), Expect = 3.7 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 8/64 (12%) Frame = +3 Query: 246 HSELNGELVHGQAIKIEAAKSRKAPST--------PTTKIFVGNLTDKTRAPEVRELFQK 401 + +L G ++ G A+ + +++++ P TK+ V N+ + E+R+LF Sbjct: 632 YRDLQGTVLDGHALILRFCENKRSDKVGKDSNKDKPCTKLHVKNIAFEATKRELRQLFSP 691 Query: 402 FGTV 413 FG + Sbjct: 692 FGQI 695 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 324 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 T TK+FVG L T + + F K+G ++E I+ Sbjct: 14 TKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVII 49 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 327 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV-RNYGFV 449 P+ + VGN++ E++ LF++FG + +N GF+ Sbjct: 215 PSRTLLVGNISSNVEDYELKVLFEQFGDIQALHTACKNRGFI 256 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-RNYGFV 214 + +GN+S + +L+ LFE++G + +N GF+ Sbjct: 219 LLVGNISSNVEDYELKVLFEQFGDIQALHTACKNRGFI 256 >At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing protein similar to SP|Q9Y4I5 Tesmin (Metallothionein-like 5, testis-specific) {Homo sapiens}; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 408 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 87 APVLSKSSSGTFLIKPQKPILDRYSKNTVRS*NAISSEITVSCTWKTNKSAAN-HSELNG 263 +PV S S T + PQKP L ++ N V+ E S ++ + N H++L Sbjct: 36 SPVKSSQQSETEVTPPQKPPLHQFGHNQVQKNRVRYCECFASGSYCNGCNCVNCHNKLEN 95 Query: 264 E 266 E Sbjct: 96 E 96 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = +3 Query: 333 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNY--------GFVHLDATGDVNDAIK 488 T + V NL R ++R F++FG V + + R+Y GF+ D +A Sbjct: 37 TSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKH 96 Query: 489 ELNGMMV 509 +++G ++ Sbjct: 97 QMDGYLL 103 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENE 229 +F+G L T+ L+ +F +YG +V I + GFV + Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEK 306 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 86 GTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVE 184 G G F +F+G+L TT+A+L KYG V E Sbjct: 231 GGGAF-LFVGDLHWWTTDAELEAELCKYGAVKE 262 >At4g01070.1 68417.m00145 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 480 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 559 PLPDTTRRQLHLHGLSVTII 500 PL + +R +HLHGL+VT + Sbjct: 22 PLVEFAKRLVHLHGLTVTFV 41 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/71 (22%), Positives = 33/71 (46%), Gaps = 8/71 (11%) Frame = +3 Query: 309 RKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV--------RNYGFVHLDAT 464 R+ + + ++FV L+ T ++++ F FG +V+ ++ + +GFV Sbjct: 26 RRCSTLTSPRLFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATI 85 Query: 465 GDVNDAIKELN 497 D A E+N Sbjct: 86 EDAEKAKAEMN 96 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 104 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV 196 +F+ +S +TE L F +YG V++ D++ Sbjct: 23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVI 53 >At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related contains weak similarity to Swiss-Prot:P10366 ATP phosphoribosyltransferase [Escherichia coli] Length = 1402 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 421 HSTTVPNF*NSSRTSGARVLSVKLPTNILVVGVDG 317 H T+ N +++TSG S+K P+ G++G Sbjct: 1270 HKVTILNLPETAQTSGLHEASIKAPSVTFGTGIEG 1304 >At5g53890.1 68418.m06703 leucine-rich repeat transmembrane protein kinase, putative Length = 1036 Score = 27.1 bits (57), Expect = 8.6 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -2 Query: 452 MHEAVVTHDIALDDRPELLKQLADFGRARLVR 357 +H V + +I LD++ E LADFG ARL+R Sbjct: 877 IHRDVKSSNILLDEKFEA--HLADFGLARLLR 906 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 318 PSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 431 P+ TKI+V L TR + F++FG +V +V Sbjct: 4 PNDRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVV 41 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 27.1 bits (57), Expect = 8.6 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 9/80 (11%) Frame = +3 Query: 183 NAISSEITVSCTWKTNKSAANHSELNGELVHGQAIKIEAA----KSRKAPST-----PTT 335 N +S + ++T +SAA N L+ G ++++ A K +K P Sbjct: 224 NEKASSVHAYVVFETEQSAAASLAHNMSLIDGNHVRVDRACPPRKKQKGHDDTHLYDPKR 283 Query: 336 KIFVGNLTDKTRAPEVRELF 395 +F+GNL + EV +LF Sbjct: 284 TVFMGNLPFDVKDEEVYQLF 303 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,442,547 Number of Sequences: 28952 Number of extensions: 224560 Number of successful extensions: 1179 Number of sequences better than 10.0: 174 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -