BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021883 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 27 0.21 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.5 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 26.6 bits (56), Expect = 0.21 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +2 Query: 233 LEREWYSASKDIKLLLLGAGESGKSTIVKQMKIIHESGFTNE 358 L RE S I + +G GKSTIVK + + F NE Sbjct: 32 LSREVISRQATINIGTIGHVAHGKSTIVKAISGVQTVRFKNE 73 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 33 ISCRVAPVVPERQDACRAHAERSVR 107 ISCR V E ACR E +R Sbjct: 627 ISCRQGTVPDETHSACRDIPEEFLR 651 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,181 Number of Sequences: 438 Number of extensions: 4117 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -