BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021882 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 92 4e-19 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 92 4e-19 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 92 4e-19 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 88 6e-18 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 82 5e-16 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 81 7e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 81 9e-16 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 81 9e-16 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 81 9e-16 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 81 9e-16 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 81 9e-16 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 81 9e-16 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 81 9e-16 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 81 9e-16 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 81 9e-16 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 81 9e-16 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 81 9e-16 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 81 9e-16 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 81 1e-15 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 80 2e-15 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 78 6e-15 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 78 6e-15 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 78 6e-15 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 78 6e-15 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 78 6e-15 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 78 6e-15 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 78 6e-15 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 78 6e-15 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 78 6e-15 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 78 6e-15 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 78 6e-15 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 78 6e-15 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 78 6e-15 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 78 6e-15 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 78 6e-15 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 78 6e-15 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 78 6e-15 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 78 6e-15 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 78 6e-15 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 78 6e-15 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 78 6e-15 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 78 6e-15 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 78 6e-15 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 78 6e-15 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 78 6e-15 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 78 6e-15 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 78 6e-15 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 78 6e-15 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 78 6e-15 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 78 6e-15 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 78 6e-15 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 78 6e-15 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 78 6e-15 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 78 6e-15 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 78 6e-15 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 78 6e-15 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 78 6e-15 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 78 6e-15 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 78 6e-15 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 78 6e-15 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 78 6e-15 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 78 6e-15 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 78 6e-15 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 78 6e-15 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 78 6e-15 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 78 6e-15 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 78 6e-15 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 78 6e-15 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 78 6e-15 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 78 6e-15 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 78 6e-15 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 78 6e-15 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 78 6e-15 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 78 6e-15 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 78 6e-15 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 78 6e-15 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 78 6e-15 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 78 6e-15 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 78 6e-15 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 78 6e-15 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 78 6e-15 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 78 6e-15 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 78 6e-15 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 78 6e-15 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 78 6e-15 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 78 6e-15 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 78 6e-15 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 92.3 bits (219), Expect = 4e-19 Identities = 44/63 (69%), Positives = 44/63 (69%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 383 HSPFRLRNCWEGRSVRAS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 645 Query: 382 ANW 374 ANW Sbjct: 646 ANW 648 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 92.3 bits (219), Expect = 4e-19 Identities = 47/56 (83%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = -2 Query: 572 YNLPFAIQAAQLL-GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 408 + PFAIQAAQLL GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 92.3 bits (219), Expect = 4e-19 Identities = 44/63 (69%), Positives = 44/63 (69%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 383 HSPFRLRNCWEGRSVRAS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 382 ANW 374 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 92.3 bits (219), Expect = 4e-19 Identities = 44/63 (69%), Positives = 44/63 (69%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 383 HSPFRLRNCWEGRSVRAS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 382 ANW 374 ANW Sbjct: 89 ANW 91 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 90.6 bits (215), Expect = 1e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +2 Query: 377 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIA 508 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAGVIA Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIA 76 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 510 EARTDRPSQQLRSLNGEW 563 EARTDRPSQQLRSLNGEW Sbjct: 78 EARTDRPSQQLRSLNGEW 95 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 89.8 bits (213), Expect = 2e-18 Identities = 46/56 (82%), Positives = 49/56 (87%), Gaps = 1/56 (1%) Frame = -2 Query: 572 YNLPFAIQAAQLL-GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 408 + PFAIQAAQL GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 89.8 bits (213), Expect = 2e-18 Identities = 46/56 (82%), Positives = 49/56 (87%), Gaps = 1/56 (1%) Frame = -2 Query: 572 YNLPFAIQAAQLL-GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 408 + PFAIQAAQL GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 88.2 bits (209), Expect = 6e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 392 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIARGP 517 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 43 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 83.8 bits (198), Expect = 1e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 383 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 502 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG+ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGL 116 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 510 EARTDRPSQQLRSLNGEW 563 EARTDRPSQQLRSLNGEW Sbjct: 120 EARTDRPSQQLRSLNGEW 137 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 83.8 bits (198), Expect = 1e-16 Identities = 39/59 (66%), Positives = 40/59 (67%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 374 +LRNCWEGRSVRAS KG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 83.0 bits (196), Expect = 2e-16 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = -2 Query: 584 NINAYNLPFAIQAAQLLGRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 405 N+ A + PF ++ GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRLRNCWE-GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 404 L 402 L Sbjct: 498 L 498 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 82.6 bits (195), Expect = 3e-16 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -2 Query: 548 AAQLL-GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 AAQL GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 82.6 bits (195), Expect = 3e-16 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSERPAPIALPNSCAA 549 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE +SCAA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCAA 100 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 4e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 392 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 502 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 38 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 510 EARTDRPSQQLRSLNGEW 563 EARTDRPSQQLRSLNGEW Sbjct: 42 EARTDRPSQQLRSLNGEW 59 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 81.8 bits (193), Expect = 5e-16 Identities = 43/62 (69%), Positives = 49/62 (79%) Frame = -2 Query: 587 QNINAYNLPFAIQAAQLLGRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 408 +N A + PF ++ GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 39 KNQGASHSPFRLRNCGE-GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 96 Query: 407 EL 402 EL Sbjct: 97 EL 98 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/41 (51%), Positives = 24/41 (58%) Frame = -3 Query: 604 FNANFNKILTLTICHSPFRLRNCWEGRSVRASRYYASWRKG 482 F F+++ HSPFRLRNC EGRSVRAS KG Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLAKG 71 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 81.4 bits (192), Expect = 7e-16 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 581 INAYNLPFAIQAAQLLGRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 + A + PF ++ GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 175 VGASHSPFRLRNCWE-GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 +LRNCWEGRSVRAS KG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 382 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKG 397 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 231 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 +LRNCWEGRSVRAS KG Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 298 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 364 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 358 LRNCWEGRSVRASSLLRQLAKG 379 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 38 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKG 53 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 RLRNCWEGRSVRAS KG Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 258 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 +LRNCWEGRSVRAS KG Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 H RLRNCWEGRSVRAS KG Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKG 287 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 125 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 119 LRNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 291 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 200 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 +LRNCWEGRSVRAS KG Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 592 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 228 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 +LRNCWEGRSVRAS KG Sbjct: 221 KLRNCWEGRSVRASSLLRQLAKG 243 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 506 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 547 LRNCWEGRSVRASRYYASWRKG 482 LRNCWEGRSVRAS KG Sbjct: 83 LRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 81.0 bits (191), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 397 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 RLRNCWEGRSVRAS KG Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKG 412 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/47 (78%), Positives = 37/47 (78%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSERPAPIALPNSCAA 549 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE CAA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 75 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/47 (78%), Positives = 37/47 (78%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSERPAPIALPNSCAA 549 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE CAA Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 558 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 80.2 bits (189), Expect = 2e-15 Identities = 41/71 (57%), Positives = 47/71 (66%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSERPAPIALPNSCAA*MANGKL*ALIFC 588 LAVVLQRRDWENPGVTQLNRLAAHPPFASW + P + L SC + ALI C Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSCVSGPIRKNDLALITC 201 Query: 589 *NSR*IFVKSA 621 + + I +SA Sbjct: 202 PSEKYIVKQSA 212 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 79.4 bits (187), Expect = 3e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 405 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 15 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 118 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 110 PFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 79.4 bits (187), Expect = 3e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 405 GR++ A SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 537 GRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 550 RLRNCWEGRSVRASRYYASWRKG 482 RLRNCWEGRSVRAS KG Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKG 552 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 79.4 bits (187), Expect = 3e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 407 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIARGP 517 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 98 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 505 SERPAPIALPNSCAA 549 ++RPAPIALPNSCAA Sbjct: 95 AKRPAPIALPNSCAA 109 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 79.4 bits (187), Expect = 3e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +2 Query: 407 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIARGP 517 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 93 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 505 SERPAPIALPNSCAA 549 ++RPAPIALPNSCAA Sbjct: 90 AKRPAPIALPNSCAA 104 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 79.0 bits (186), Expect = 4e-15 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -2 Query: 548 AAQLL-GRAIGAGLSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 AAQL GR++ A SLLRQLAKGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 79.0 bits (186), Expect = 4e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSER 513 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE+ Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 157 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF +ARTDRPSQQLRSLNGEW Sbjct: 148 PFASWRNSEKARTDRPSQQLRSLNGEW 174 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 79.0 bits (186), Expect = 4e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSER 513 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 92 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF +ARTDRPSQQLRSLNGEW Sbjct: 83 PFASWRNSEKARTDRPSQQLRSLNGEW 109 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.6 bits (185), Expect = 5e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSER 513 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQ 70 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF +ARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEQARTDRPSQQLRSLNGEW 87 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 78.6 bits (185), Expect = 5e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 509 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 78.6 bits (185), Expect = 5e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 509 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 402 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 68 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 95 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 77 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 69 PFASWRNSEEARTDRPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 71 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 91 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 79 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 68 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 58 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 78 PFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 102 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 73 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 249 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 241 PFASWRNSEEARTDRPSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 144 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 136 PFASWRNSEEARTDRPSQQLRSLNGEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 82 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 61 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 49 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 80 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 414 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 406 PFASWRNSEEARTDRPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 132 PFASWRNSEEARTDRPSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 116 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 72 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 41 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 51 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 71 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 136 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 128 PFASWRNSEEARTDRPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 78 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 373 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 365 PFASWRNSEEARTDRPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 113 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 105 PFASWRNSEEARTDRPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 49 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 167 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 159 PFASWRNSEEARTDRPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 72 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 176 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 168 PFASWRNSEEARTDRPSQQLRSLNGEW 194 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 866 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNILLKFAL 602 PF EARTDRPSQQLRSLNGEW+++ +L L Sbjct: 858 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLIL 897 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 49 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 93 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 67 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 106 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 89 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 102 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 289 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 281 PFASWRNSEEARTDRPSQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 147 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 70 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 126 PFASWRNSEEARTDRPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 147 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 72 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 53 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 91 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 70 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 67 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 44 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 52 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 429 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 421 PFASWRNSEEARTDRPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 78 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 87 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 152 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 144 PFASWRNSEEARTDRPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 88 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 98 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 101 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 93 PFASWRNSEEARTDRPSQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 447 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 439 PFASWRNSEEARTDRPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 144 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 136 PFASWRNSEEARTDRPSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 89 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 79 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 194 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 186 PFASWRNSEEARTDRPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 98 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 85 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 77 PFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 121 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 70 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 75 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 67 PFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 218 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 210 PFASWRNSEEARTDRPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 67 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 73 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 87 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 76 PFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 67 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 68 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 72 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 165 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 157 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 74 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 117 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 55 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 186 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 178 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 373 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 365 PFASWRNSEEARTDRPSQQLRSLNGEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 90 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 54 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 134 PFASWRNSEEARTDRPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 119 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 111 PFASWRNSEEARTDRPSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 93 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 327 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 319 PFASWRNSEEARTDRPSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 91 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 49 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 444 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 436 PFASWRNSEEARTDRPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 128 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 120 PFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 76 PFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 118 PFASWRNSEEARTDRPSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 244 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 236 PFASWRNSEEARTDRPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 246 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 238 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 66 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 81 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 71 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 180 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 172 PFASWRNSEEARTDRPSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 78 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 68 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 88 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 73 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 108 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 228 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 220 PFASWRNSEEARTDRPSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 78 PFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 65 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 119 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 111 PFASWRNSEEARTDRPSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 55 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 220 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 212 PFASWRNSEEARTDRPSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 83 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 90 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNILLK 593 PF EARTDRPSQQLRSLNGEW+++ + K Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 109 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 101 PFASWRNSEEARTDRPSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 129 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEW 147 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 106 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 73 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 82 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 663 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 696 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 688 PFASWRNSEEARTDRPSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 70 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 61 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 179 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 71 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 92 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 121 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 69 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 1223 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 562 HSPFRLRNCWEGRSVRASRYYASWRKG 482 HSPFRLRNCWEGRSVRAS KG Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKG 430 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIV 572 PF EARTDRPSQQLRSLNGEW+++ Sbjct: 1215 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 533 GRAIGAGLSLLRQLAKGGCAARRLSW 456 GR++ A SLLRQLAKGGCAARRLSW Sbjct: 415 GRSVRAS-SLLRQLAKGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 75 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEW 563 PF EARTDRPSQQLRSLNGEW Sbjct: 67 PFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 65 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 409 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 158 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 483 PFRQLA**REARTDRPSQQLRSLNGEWQIVSVNIL 587 PF EARTDRPSQQLRSLNGEW+++ +L Sbjct: 150 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,015,417 Number of Sequences: 59808 Number of extensions: 541863 Number of successful extensions: 9806 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9730 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -